Search results for "source"

showing 10 items of 6139 documents

Hydrogen plasma induced photoelectron emission from low work function cesium covered metal surfaces

2017

Experimental results of hydrogen plasma induced photoelectron emission from cesium covered metal surfaces under ion source relevant conditions are reported. The transient photoelectron current during the Cs deposition process is measured from Mo, Al, Cu, Ta, Y, Ni, and stainless steel (SAE 304) surfaces. The photoelectron emission is 2–3.5 times higher at optimal Cs layer thickness in comparison to the clean substrate material. Emission from the thick layer of Cs is found to be 60%–80% lower than the emission from clean substrates. peerReviewed

010302 applied physicsPhysicsta114HydrogenTantalumAnalytical chemistrytransitionchemistry.chemical_elementSubstrate (electronics)plasmasCondensed Matter Physics01 natural sciencesIon sourcework functions010305 fluids & plasmasion sourceschemistryAluminiumCaesium0103 physical sciencesWork functionLayer (electronics)photoemissionPhysics of Plasmas
researchProduct

Cyclotron instability in the afterglow mode of minimum-B ECRIS.

2016

It was shown recently that cyclotron instability in non-equilibrium plasma of a minimum-B electron cyclotron resonance ion source (ECRIS) causes perturbation of the extracted ion current and generation of strong bursts of bremsstrahlung emission, which limit the performance of the ion source. The present work is devoted to the dynamic regimes of plasma instability in ECRIS operated in pulsed mode. Instability develops in decaying plasma shortly after heating microwaves are switched off and manifests itself in the form of powerful pulses of electromagnetic emission associated with precipitation of high energy electrons. Time-resolved measurements of microwave emission bursts are presented. I…

010302 applied physicsPhysicsta114ta213Astrophysics::High Energy Astrophysical Phenomenaplasma instabilityCyclotronBremsstrahlungPlasma01 natural sciencesInstabilityIon sourceElectron cyclotron resonance010305 fluids & plasmaslaw.inventionTwo-stream instabilityPhysics::Plasma Physicslaw0103 physical scienceselectron cyclotron resonance ion sourcesAtomic physicsInstrumentationIon cyclotron resonanceThe Review of scientific instruments
researchProduct

Fundamentals on the Molecular Mechanism of Action of Antimicrobial Peptides

2019

Abstract Antimicrobial peptides (AMPs) are produced by several organisms as their first line of defense. Constituted by amino acids, they may present different mechanisms of action. The antimicrobial activity can be used by the peptide-producing organism itself, as innate immune strategy, or in the industry, applying as natural source preservatives. Understanding the possibilities of the operation of these compounds is a prerequisite for the development of effective uses, as well as for the establishment of combinations, which can even expand their applications considering the possibilities of genetic manipulations. Thus, the objective of this article is to review the basic principles of AM…

010302 applied physicsPhysiological functionMaterials scienceInnate immune systemComputer scienceFirst lineAntimicrobial peptides02 engineering and technology021001 nanoscience & nanotechnologyAntimicrobial01 natural sciencesAction (philosophy)0103 physical sciencesNatural sourceMolecular mechanismGeneral Materials ScienceBiochemical engineering0210 nano-technologyOrganismSSRN Electronic Journal
researchProduct

Online Management of Hybrid DRAM-NVMM Memory for HPC

2019

Non-volatile main memories (NVMMs) offer a comparable performance to DRAM, while requiring lower static power consumption and enabling higher densities. NVMM therefore can provide opportunities for improving both energy efficiency and costs of main memory. Previous hybrid main memory management approaches for HPC either do not consider the unique characteristics of NVMMs, depend on high profiling costs, or need source code modifications. In this paper, we investigate HPC applications' behaviors in the presence of NVMM as part of the main memory. By performing a comprehensive study of HPC applications and based on several key observations, we propose an online hybrid memory architecture for …

010302 applied physicsProfiling (computer programming)Source codebusiness.industryComputer sciencemedia_common.quotation_subject02 engineering and technology01 natural sciences020202 computer hardware & architectureNon-volatile memoryMemory managementEmbedded system0103 physical sciencesMemory architecture0202 electrical engineering electronic engineering information engineeringKey (cryptography)businessDrammedia_common2019 IEEE 26th International Conference on High Performance Computing, Data, and Analytics (HiPC)
researchProduct

Lead evaporation instabilities and failure mechanisms of the micro oven at the GTS-LHC ECR ion source at CERN

2020

The GTS-LHC ECR ion source (named after the Grenoble Test Source and the Large Hadron Collider) at CERN provides heavy ion beams for the chain of accelerators from Linac3 up to the LHC for high energy collision experiments and to the Super Proton Synchrotron for fixed target experiments. During the standard operation, the oven technique is used to evaporate lead into the source plasma to produce multiple charged lead ion beams. Intensity and stability are key parameters for the beam, and the operational experience is that some of the source instabilities can be linked to the oven performance. Over long operation periods of several weeks, the evaporation is not stable which makes the tuning …

010302 applied physicsRange (particle radiation)Large Hadron ColliderMaterials scienceionitNuclear engineeringEvaporationPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesSuper Proton SynchrotronIon source010305 fluids & plasmasIonComputer Science::OtherPhysics::Popular Physics0103 physical scienceslyijyInstrumentationBeam (structure)
researchProduct

Addressing Manufacturing Challenges with Cost-Efficient Fault Tolerant Routing

2010

The high-performance computing domain is enriching with the inclusion of Networks-on-chip (NoCs) as a key component of many-core (CMPs or MPSoCs) architectures. NoCs face the communication scalability challenge while meeting tight power, area and latency constraints. Designers must address new challenges that were not present before. Defective components, the enhancement of application-level parallelism or power-aware techniques may break topology regularity, thus, efficient routing becomes a challenge.In this paper, uLBDR (Universal Logic-Based Distributed Routing) is proposed as an efficient logic-based mechanism that adapts to any irregular topology derived from 2D meshes, being an alter…

010302 applied physicsStatic routingDynamic Source Routingnetwork on chip; routing; manufacturing faultComputer sciencebusiness.industryRouting tableDistributed computingPolicy-based routing02 engineering and technology01 natural sciences020202 computer hardware & architecturenetwork on chipRouting domainLink-state routing protocolrouting0103 physical sciencesMultipath routing0202 electrical engineering electronic engineering information engineeringmanufacturing faultbusinessHierarchical routingComputer network
researchProduct

Gasdynamic ECR ion source for negative ion production

2018

H− ion sources are needed in various areas of accelerator technology, such as beam injection into cyclotrons and storage rings and as a part of neutral beam injectors for plasma heating in experimental facilities studying thermonuclear fusion. It was recently demonstrated that gasdynamic ion source based on ECR discharge in a simple mirror trap is very efficient for proton beam production [1]. Here we use the gasdynamic plasma source as the first stage driver of volumetric negative ion production through dissociative electron attachment (DEA) [2]. Experiments were performed with a pulsed 37 GHz / up to 100 kW gyrotron radiation in a dual-trap magnetic system, which consists of two identical…

010302 applied physicsThermonuclear fusionMaterials scienceCyclotronElectronPlasma01 natural sciencesIon sourcelaw.inventionIonPhysics::Plasma PhysicslawGyrotron0103 physical sciencesPhysics::Accelerator PhysicsAtomic physics010306 general physicsInstrumentationMathematical PhysicsBeam (structure)Journal of Instrumentation
researchProduct

The Effect of the Harmonic Content Generated by AC/DC Modular Multilevel Converters on HVDC Cable Systems

2019

With the increasing penetration of renewable and decentralized energy sources into the power grid, an extended use of DC voltages is expected on both distribution and transmission levels. Generation of DC voltages by means of voltage source converters is associated with a wide spectrum of harmonic distortions at converter terminals, both on the ac and on the dc sides. This can lead to partial discharges in power cables, which deteriorate insulation material thus weakening its performance and reducing cable life-time. In the previously published paper, the effect of harmonic distortion on appearance of partial discharges in cable insulation was evaluated. Here, the study related to the PD be…

010302 applied physicsTotal harmonic distortionbusiness.industryComputer scienceripple020209 energyElectrical engineering02 engineering and technologyDC streConvertersmultilevel converter01 natural sciencesHarmonic analysisSynchronization (alternating current)partial dischargeSettore ING-IND/31 - ElettrotecnicaharmonicHarmonics0103 physical sciences0202 electrical engineering electronic engineering information engineeringHarmonicPDWaveformVoltage sourcebusiness2019 IEEE Conference on Electrical Insulation and Dielectric Phenomena (CEIDP)
researchProduct

An Experimental Study of Waveguide Coupled Microwave Heating with Conventional Multicusp Negative Ion Source

2015

Negative ion production with conventional multicusp plasma chambers utilizing 2.45 GHz microwave heating is demonstrated. The experimental results were obtained with the multicusp plasma chambers and extraction systems of the RFdriven RADIS ion source and the filament driven arc discharge ion source LIISA. A waveguide microwave coupling system, which is almost similar to the one used with the SILHI ion source, was used. The results demonstrate that at least one third of negative ion beam obtained with inductive RF-coupling (RADIS) or arc discharge (LIISA) can be achieved with 1 kW of 2.45 GHz microwave power in CW mode without any modification of the plasma chamber. The co-extracted electro…

010302 applied physicsWaveguide (electromagnetism)Materials scienceFOS: Physical sciencesPlasmaElectron7. Clean energy01 natural sciencesIon sourcePhysics - Plasma Physics010305 fluids & plasmasIonPlasma Physics (physics.plasm-ph)Electric arcPhysics::Plasma Physics0103 physical sciencesAtomic physicsMicrowaveBeam (structure)
researchProduct

The role of radio frequency scattering in high-energy electron losses from minimum-B ECR ion source

2021

Abstract The measurement of the axially lost electron energy distribution escaping from a minimum-B electron cyclotron resonance ion source in the range of 4–800 keV is reported. The experiments have revealed the existence of a hump at 150–300 keV energy, containing up to 15% of the lost electrons and carrying up to 30% of the measured energy losses. The mean energy of the hump is independent of the microwave power, frequency and neutral gas pressure but increases with the magnetic field strength, most importantly with the value of the minimum-B field. Experiments in pulsed operation mode have indicated the presence of the hump only when microwave power is applied, confirming that the origi…

010302 applied physics[PHYS]Physics [physics]High energyMaterials scienceScatteringAstrophysics::High Energy Astrophysical Phenomena[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]scatteringElectronhiukkaskiihdyttimetCondensed Matter Physicselektronit01 natural sciences7. Clean energyIon source010305 fluids & plasmasNuclear Energy and Engineering0103 physical sciencessirontaRadio frequencyAtomic physics
researchProduct