Search results for "systems"

showing 10 items of 11952 documents

Regulating role of lumbricid macrofauna in Atrazine biodegradation in temperate cropped soil.

2004

communication oraleFR2116communication orale

stomatognathic diseasesInformationSystems_MODELSANDPRINCIPLESComputingMilieux_THECOMPUTINGPROFESSIONGeneralLiterature_INTRODUCTORYANDSURVEYComputingMilieux_COMPUTERSANDEDUCATION[ SDU.ENVI ] Sciences of the Universe [physics]/Continental interfaces environment[SDU.ENVI]Sciences of the Universe [physics]/Continental interfaces environment[SDU.ENVI] Sciences of the Universe [physics]/Continental interfaces environment
researchProduct

Interactions biotiques entre macrofaune lombricienne et les communautés microbiennes, indigènes et bioaugmentées, dégradant l'atrazine en sol tempéré.

2004

communication oraleFR2116communication orale

stomatognathic diseasesInformationSystems_MODELSANDPRINCIPLESComputingMilieux_THECOMPUTINGPROFESSIONGeneralLiterature_INTRODUCTORYANDSURVEY[ SDU.ENVI ] Sciences of the Universe [physics]/Continental interfaces environmentComputingMilieux_COMPUTERSANDEDUCATION[SDU.ENVI]Sciences of the Universe [physics]/Continental interfaces environment[SDU.ENVI] Sciences of the Universe [physics]/Continental interfaces environment
researchProduct

Biodégradation de l'atrazine en sols tempérés : rôle régulateur d'un modèle d'interaction biotique macrofaune/bactérie.

2004

communication orale

stomatognathic diseasesInformationSystems_MODELSANDPRINCIPLESComputingMilieux_THECOMPUTINGPROFESSIONGeneralLiterature_INTRODUCTORYANDSURVEY[ SDU.ENVI ] Sciences of the Universe [physics]/Continental interfaces environmentComputingMilieux_COMPUTERSANDEDUCATION[SDU.ENVI]Sciences of the Universe [physics]/Continental interfaces environment[SDU.ENVI] Sciences of the Universe [physics]/Continental interfaces environment
researchProduct

L1: Oral processing behaviours and retronasal aroma release variability during cheese consumption in human

2012

Abstract of oral presentation

stomatognathic diseases[SDV.AEN] Life Sciences [q-bio]/Food and NutritionInformationSystems_MODELSANDPRINCIPLESComputingMilieux_THECOMPUTINGPROFESSIONGeneralLiterature_INTRODUCTORYANDSURVEY[ SDV.AEN ] Life Sciences [q-bio]/Food and NutritionComputingMilieux_COMPUTERSANDEDUCATION[SDV.AEN]Life Sciences [q-bio]/Food and Nutrition
researchProduct

Impact of supplier-specific investments in inter-organisational information systems on strategic electronic coordination: the moderation effect of bu…

2018

Abstract This paper examines the factors which influence sharing of the strategic information (in other words, electronic coordination) in a buyer–supplier dyad. The antecedents of this coordination are examined rather well in the transaction cost economics (TCE) theory and resource-dependency theory (RDT), while the supply chain management perspective is contemplated. The mentioned frameworks are used in the analysis. However, the research focus is narrowed down to the exploration of the antecedents of information exchange conducted via inter-organisational information systems (IOS). The empirical analysis is based on 198 observations of Norwegian companies operating in different types of …

strategic electronic coordinationResource dependence theoryTS155-194Strategy and Management05 social sciences02 engineering and technologyspecific ios investmentModerationresource dependency theorytransaction cost economics (tce)inter-organisational information system (ios)Industrial and Manufacturing EngineeringManagement Information Systems020204 information systemsManagement of Technology and Innovation0502 economics and business0202 electrical engineering electronic engineering information engineeringInformation system050211 marketingbuyer dependencyBusinessProduction management. Operations managementBusiness managementIndustrial organizationEngineering Management in Production and Services
researchProduct

The Radó–Kneser–Choquet theorem for $p$-harmonic mappings between Riemannian surfaces

2020

In the planar setting the Rad\'o-Kneser-Choquet theorem states that a harmonic map from the unit disk onto a Jordan domain bounded by a convex curve is a diffeomorphism provided that the boundary mapping is a homeomorphism. We prove the injectivity criterion of Rad\'o-Kneser-Choquet for $p$-harmonic mappings between Riemannian surfaces. In our proof of the injecticity criterion we approximate the $p$-harmonic map with auxiliary mappings that solve uniformly elliptic systems. We prove that each auxiliary mapping has a positive Jacobian by a homotopy argument. We keep the maps injective all the way through the homotopy with the help of the minimum principle for a certain subharmonic expressio…

subharmonicityPure mathematicsFUNCTIONALSMINIMIZERSGeneral Mathematicsp-harmonic mappings01 natural sciencesJacobin matriisitMathematics - Analysis of PDEsMaximum principleBOUNDARY-REGULARITYSYSTEMSMAPSRiemannian surface111 MathematicsFOS: MathematicsComplex Variables (math.CV)0101 mathematicsMathematicsCurvatureMathematics - Complex VariablesHomotopy010102 general mathematicsConvex curveHarmonic mapUnit diskHomeomorphismInjective functionEXISTENCEUNIQUENESSmaximum principlecurvature35J47 (Primary) 58E20 35J70 35J92 (Secondary)ELLIPTIC PROBLEMSDiffeomorphismJacobianunivalentAnalysis of PDEs (math.AP)Revista Matemática Iberoamericana
researchProduct

Towards Automated Classification of Firmware Images and Identification of Embedded Devices

2017

Part 4: Operating System and Firmware Security; International audience; Embedded systems, as opposed to traditional computers, bring an incredible diversity. The number of devices manufactured is constantly increasing and each has a dedicated software, commonly known as firmware. Full firmware images are often delivered as multiple releases, correcting bugs and vulnerabilities, or adding new features. Unfortunately, there is no centralized or standardized firmware distribution mechanism. It is therefore difficult to track which vendor or device a firmware package belongs to, or to identify which firmware version is used in deployed embedded devices. At the same time, discovering devices tha…

sulautettu tietotekniikkaComputer scienceVendorvulnerability02 engineering and technologycomputer.software_genreSoftware020204 information systems0202 electrical engineering electronic engineering information engineering[INFO]Computer Science [cs]tietoturvadata securityhaavoittuvuusbusiness.industryFirmwareFingerprint (computing)020206 networking & telecommunicationsubiquitous computingRandom forestIdentification (information)koneoppiminenmachine learningEmbedded systemUser interfaceHardware_CONTROLSTRUCTURESANDMICROPROGRAMMINGbusinesscomputerPrivate network
researchProduct

Insecure Firmware and Wireless Technologies as “Achilles’ Heel” in Cybersecurity of Cyber-Physical Systems

2022

In this chapter, we analyze cybersecurity weaknesses in three use-cases of real-world cyber-physical systems: transportation (aviation), remote explosives and robotic weapons (fireworks pyrotechnics), and physical security (CCTV). The digitalization, interconnection, and IoT-nature of cyber-physical systems make them attractive targets. It is crucial to ensure that such systems are protected from cyber attacks, and therefore it is equally important to study and understand their major weaknesses. peerReviewed

sulautettu tietotekniikkacybersecurityprotocolsasejärjestelmätilmailucyber-physical systemsfirmwaretakaisinmallinnusvideo surveillanceesineiden internetCCTVkyberturvallisuushaavoittuvuusvulnerabilitieswireless pyrotechnicsremote firing systemsexploitsvalvontajärjestelmätreverse engineeringZigbeeprotokollatcritical infrastructureaviationRFinfrastruktuuritbinareADS-B
researchProduct

Digital processing of environmental noise samples

2014

sulautettu tietotekniikkahuman auditory systemARM assembly languageäänitekniikkamittausmonitorointiARM architecturekuuloA-weighting filtermelumittaustekniikkaäänenvoimakkuusfixed-point implementationäänenkäsittelyaltistuminenembedded systemsenvironmental noisevalvonta
researchProduct

Designing and Evaluating Ubicomp Characteristics of Intelligent In-Car Systems

2022

In this paper, we present a preliminary taxonomy for designing and evaluating intelligent systems from the viewpoint of ubiquitous computing (ubicomp). As an example of intelligent systems, we examine a few novel in-car systems, which are already commercially available. We also discuss some ergonomics issues related to the design of in-car systems and argue that rationale for solving these issues can be found from the ideal qualities of ubicomp systems. The five characteristics we define to be ideal for genuine ubicomp systems are context-awareness, natural interaction methods, invisibility, support for everyday tasks, and interconnectivity. Based on these characteristics, we create a frame…

sulautettu tietotekniikkain-car systemsAHFE International
researchProduct