Search results for "time"

showing 10 items of 12336 documents

The Supranational Dimension in Max Weber’s Vision of Politics

2019

Max Weber analyzed politics from the perspective of Chancen for actors, and he never separated world politics from domestic politics. The “Westphalian balance” between great European powers shaped Weber’s views on international polity. However, he also regarded Western individualism, human rights, and parliamentary democracy as necessary qualities to possess in order to be recognized as a great power. This vision provided the basis for his wartime critique of the expansionist tendencies in German foreign policy and for his demand for the parliamentarization of German politics. After the end of World War I, Weber used Woodrow Wilson’s idea of the League of Nations as the basis for a proposal…

supranationalismYhdistyneet kansakunnat (YK)Euroopan unioni (EU)United NationsWeber MaxMax Weberworld politicskansainvälinen politiikkaKansainliittosota-aikaPoliticsinternational polityLeague of NationsWestphalian balanceylikansallisuusPolitical sciencejournalismimedia_common.cataloged_instancewartime journalismEuropean UnionDimension (data warehouse)European unionLaw and economicsmedia_common
researchProduct

UV-VISIBLE LUMINESCENCE OF SILICA NANOPARTICLES

surface reactionspoint defecttime-resolved photoluminescenceSettore FIS/01 - Fisica SperimentaleluminescenceUV laser radiationSilica nanoparticleelectron-phonon coupling
researchProduct

Scattering of Co-Current Surface Waves on an Analogue Black Hole

2018

We report on what is to our knowledge the first scattering experiment of surface waves on an accelerating transcritical flow, which in the analogue gravity context is described by an effective spacetime with a black-hole horizon. This spacetime has been probed by an incident co-current wave, which partially scatters into an outgoing countercurrent wave on each side of the horizon. The measured scattering amplitudes are compatible with the predictions of the hydrodynamical theory, where the kinematical description in terms of the effective metric is exact.

surface: deformationGeneral Physics and AstronomyFOS: Physical sciencesContext (language use)General Relativity and Quantum Cosmology (gr-qc)black hole: horizonGravitation and Astrophysics01 natural sciences7. Clean energyGeneral Relativity and Quantum CosmologyGeneral Relativity and Quantum Cosmology0103 physical scienceswave: scatteringsurfaceeffect: Hawkingcorrelation function010306 general physicsPhysicsSpacetimeScatteringHorizonFluid Dynamics (physics.flu-dyn)Physics - Fluid Dynamics[PHYS.PHYS.PHYS-GEN-PH]Physics [physics]/Physics [physics]/General Physics [physics.gen-ph]Scattering amplitudeBlack holeFlow (mathematics)space-timeSurface waveQuantum electrodynamics[PHYS.GRQC]Physics [physics]/General Relativity and Quantum Cosmology [gr-qc]
researchProduct

Quality-control procedure for dry-process rubberised asphalt mastics

2019

Crumb Rubber (CR) can be incorporated into asphalt mixes via the dry process by directly adding CR into the mixer together with other asphalt mixture’s components, or with the wet process where the CR is used as a bitumen modifier. While the wet process allows an accurate monitoring of the interaction between CR and bitumen, the lack of control represents a main issue in the dry process. In fact, in the latter the CR particles keep swelling during hauling and possibly also after paving operations, often causing workability issues and premature failures. This study wants to provide a methodology that could help quality control procedures of bitumen/filler/rubber systems during mixing, haulin…

swelling proceasphalt mixtureMaterials sciencebusiness.industrymedia_common.quotation_subjectControl (management)pre-treatment of crumb rubberProcess (computing)Viscosity over timeQuality-controlrubberised asphalt masticdry-procereal-time viscosity measurementAsphaltSettore ICAR/04 - Strade Ferrovie Ed AeroportiQuality (business)Process engineeringbusinessCrumb Rubbermedia_common
researchProduct

Different dynamic regimes of stimulated electron-cyclotron emission from mirror-confined non-equilibrium plasma

2019

syklotronithiukkaskiihdyttimetplasmafysiikka
researchProduct

$$\mathscr {K}$$-Convergence of Finite Volume Solutions of the Euler Equations

2020

We review our recent results on the convergence of invariant domain-preserving finite volume solutions to the Euler equations of gas dynamics. If the classical solution exists we obtain strong convergence of numerical solutions to the classical one applying the weak-strong uniqueness principle. On the other hand, if the classical solution does not exist we adapt the well-known Prokhorov compactness theorem to space-time probability measures that are generated by the sequences of finite volume solutions and show how to obtain the strong convergence in space and time of observable quantities. This can be achieved even in the case of ill-posed Euler equations having possibly many oscillatory s…

symbols.namesakeFinite volume methodSpacetimeCompactness theoremsymbolsApplied mathematicsObservableUniquenessInvariant (physics)Euler equationsMathematicsProbability measure
researchProduct

The Radon-Wigner Transform and Its Application to First-order Optical Systems

2009

The Radon-Wigner transform is presented as a tool for the description of 1st-order optical systems. The input/output relationships for this phase-space representation are obtained and their application in analysis and design tasks is pointed out.

symbols.namesakeFourier transformComputer scienceHartley transformComputingMethodologies_IMAGEPROCESSINGANDCOMPUTERVISIONsymbolsShort-time Fourier transformHarmonic wavelet transformS transformAlgorithmConstant Q transformDiscrete Fourier transformFractional Fourier transformFrontiers in Optics 2009/Laser Science XXV/Fall 2009 OSA Optics & Photonics Technical Digest
researchProduct

Modelling Systemic Cojumps with Hawkes Factor Models

2013

Instabilities in the price dynamics of a large number of financial assets are a clear sign of systemic events. By investigating a set of 20 high cap stocks traded at the Italian Stock Exchange, we find that there is a large number of high frequency cojumps. We show that the dynamics of these jumps is described neither by a multivariate Poisson nor by a multivariate Hawkes model. We introduce a Hawkes one factor model which is able to capture simultaneously the time clustering of jumps and the high synchronization of jumps across assets.

symbols.namesakeMultivariate statisticsStock exchangeEconometricssymbolsEconomicsPoisson distributionSynchronizationTime clusteringFactor analysisSign (mathematics)SSRN Electronic Journal
researchProduct

Self-regulation mechanism of an ecosystem in a non-Gaussian fluctuation regime

1996

We study a dynamical model for an ecological network of many interacting species. We consider a Malthus-Verhulst type of self-regulation mechanism. In the framework of the mean field theory we study the nonlinear relaxation in three different cases: (a) towards the equilibrium state, (b) towards the absorbing barrier, (c) at the critical point. We obtain asymptotic behavior in all different cases for the time average of the process. The dynamical behavior of the system, in the limit of infinitely many interacting species, is investigated in the stability and instability conditions and theoretical results are compared with numerical simulations. \textcopyright{} 1996 The American Physical So…

symbols.namesakeNonlinear systemMean field theoryThermodynamic equilibriumCritical point (thermodynamics)GaussiansymbolsTime averageStatistical physicsInstabilityEcological networkMathematics
researchProduct

Improved Quadratic Time-frequency Distributions for Detecting Inter-turn Short Circuits of PMSMs in Transient States

2020

This paper aims to improve quadratic time-frequency distributions to adapt condition monitoring of electrical machines in transient states. Short-Time Fourier transform (STFT) has been a baseline signal processing technique for detecting fault characteristic frequencies. However, limits of window sizes due to loss of frequency- or time-resolution, make it hard to capture rapid changes in frequencies. Within this study, Choi-Williams and Wigner-Ville distributions are proposed to effectively detect peaks at characteristic frequencies while still maintaining low computation time. The improved quadratic time-frequency distributions allow for generating spectrograms of a longer lasting data sig…

symbols.namesakeSignal processingFourier transformQuadratic equationComputer scienceShort-time Fourier transformsymbolsCondition monitoringSpectrogramTransient (oscillation)AlgorithmVDP::Teknologi: 500::Elektrotekniske fag: 540Time–frequency analysis
researchProduct