Search results for "unity"

showing 10 items of 3852 documents

Mapping routine measles vaccination in low- and middle-income countries

2021

The safe, highly effective measles vaccine has been recommended globally since 1974, yet in 2017 there were more than 17 million cases of measles and 83,400 deaths in children under 5 years old, and more than 99% of both occurred in low- and middle-income countries (LMICs)1–4. Globally comparable, annual, local estimates of routine first-dose measles-containing vaccine (MCV1) coverage are critical for understanding geographically precise immunity patterns, progress towards the targets of the Global Vaccine Action Plan (GVAP), and high-risk areas amid disruptions to vaccination programmes caused by coronavirus disease 2019 (COVID-19)5–8. Here we generated annual estimates of routine childhoo…

and promotion of well-beingVacunación MasivaInternationalityDisease preventionchildren under 5 years oldGeographic MappingRural Healthmedicine.disease_causeCross-reactivity0302 clinical medicineRA0421Vaccination Refusal030212 general & internal medicineChildimmunity patternsPediatric0303 health sciencesPublic healthMultidisciplinarybiologyVaccinationUncertaintyIMMUNIZATION3142 Public health care science environmental and occupational healthCOVERAGE3. Good healthTIME3.4 VaccinesChild PreschoolInfectious diseasesA990 Medicine and Dentistry not elsewhere classifiedAntibodyEngineering sciences. TechnologyAFRICAGeneral Science & TechnologySevere acute respiratory syndrome coronavirus 2 (SARS-CoV-2)Disease prevention ; COVID-19 ; Public health ; Infectious diseases610 Medicine & healthGlobal Vaccine Action Plan (GVAP)Local Burden of Disease Vaccine Coverage CollaboratorsArticleVaccine Related03 medical and health sciencesmeasles vaccineMeasels ; Vaccination ; Low- and middle-income countries ; Local burden of disease ; Public healthClinical ResearchmedicineHumansHealthcare DisparitiesPreschoolPROGRESS030304 developmental biologybusiness.industryMORTALITYDeveloped CountriesPreventionCommentVacunaciónUrban HealthCOVID-19Prevention of disease and conditionsVirologyCoronavirusGood Health and Well BeingCobertura de Vacunaciónbiology.proteinImmunizationbusinessMeasles
researchProduct

Molecular mechanisms of primary and secondary mucosal immunity using avian infectious bronchitis virus as a model system

2007

Although mucosal immune responses are critical for protection of hosts from clinical illness and even mortality caused by mucosal pathogens, the molecular mechanism of mucosal immunity, which is independent of systemic immunity, remains elusive. To explore the mechanistic basis of mucosal protective immunity, gene transcriptional profiling in mucosal tissues was evaluated after the primary and secondary immunization of animals with an attenuated avian infectious bronchitis virus (IBV), a prototype of Coronavirus and a well-characterized mucosal pathogen. Results showed that a number of innate immune factors including toll-like receptors (TLRs), retinoic-acid-inducible gene-1 (RIG-1), type I…

animal diseasesRespiratory Tract DiseasesLymphocyte Activationmedicine.disease_causeDC dendritic cellMucosal immunityCXCR chemokine (C-X-C motif) receptorCCR chemokine (C-C motif) receptorOligonucleotide Array Sequence AnalysisCoronavirusbiologyReverse Transcriptase Polymerase Chain ReactionAcquired immune systemSpecific Pathogen-Free OrganismsCytokinesAntibodyAvian infectious bronchitis virusCoronavirus InfectionsIBV infectious bronchitis virusInfectious bronchitis virusImmunologychemical and pharmacologic phenomenaArticlePrimary and secondary immunityMolecular mechanismIBVTranscriptional regulationImmune systemImmunitymedicineAnimalsIFN interferonTLR toll-like receptorImmunity MucosalPoultry DiseasesInnate immune systemGeneral VeterinaryGene Expression ProfilingComplement System ProteinsTh1 Cellsbiochemical phenomena metabolism and nutritionCTL cytotoxic T lymphocytebiology.organism_classificationIg immunoglobulinIL interleukinMucosal immunologyImmunologybiology.proteinRNAbacteriaImmunizationChickensVeterinary Immunology and Immunopathology
researchProduct

Toll signal transduction pathway in bivalves: Complete cds of intermediate elements and related gene transcription levels in hemocytes of immune stim…

2014

Based on protein domain structure and organization deduced from mRNA contigs, 15 transcripts of the Toll signaling pathway have been identified in the bivalve, Mytilus galloprovincialis. Identical searches performed on publicly available Mytilus edulis ESTs revealed 11 transcripts, whereas searches performed in genomic and new transcriptome sequences of the Pacific oyster, Crassostrea gigas, identified 21 Toll-related transcripts. The remarkable molecular diversity of TRAF and IKK coding sequences of C. gigas, suggests that the sequence data inferred from Mytilus cDNAs may not be exhaustive. Most of the Toll pathway genes were constitutively and ubiquitously expressed in M. galloprovinciali…

animal structuresMolluskToll signaling pathwayInnate immunity; Mollusks; Mytilus; Signal transduction; Toll pathway; NF-κBImmunologyProtein domainSettore BIO/05 - ZoologiaMytiluSignal transductionNF-κBTranscriptomeTranscription (biology)Animals[SDU.STU.HY]Sciences of the Universe [physics]/Earth Sciences/HydrologyGenePhylogenyComputingMilieux_MISCELLANEOUSMytilusInnate immunityMessenger RNAInnate immune systemMollusksToll-like receptors; signal transduction; Mytilus-galloprovincialis Lmk (bivalvia)biologyEcologyfungiMytilus-galloprovincialis Lmk (bivalvia)biology.organism_classificationMytilusToll-like receptorsCell biologyInnate immunity; Mollusks; Mytilus; NF-κB; Signal transduction; Toll pathwayToll pathwayNF-jBDevelopmental Biology
researchProduct

Hsp60 in Inflammatory Disorders

2019

Heat shock proteins (HSP) including HSP60 are immunogenic proteins shared by particular microbial agents and mammals. HSP60 has been implicated in multiple inflammatory disorders and autoimmune diseases mostly through its interactions with the immune system. Such diseases include inflammatory bowel disease, chronic obstructive pulmonary disease, Hashimoto’s thyroiditis, myasthenia gravis, multiple sclerosis and even atherosclerosis plaques among others. It is present in the cytosol, cell membrane, cell surface as well as in the extracellular space and in the circulation. As a super antigen, HSP60 has the dual role as an immunomodulator and as a biomarker, a node molecule in balance between …

animal structuresbusiness.industryMultiple sclerosisfungichemical and pharmacologic phenomenaDiseasemedicine.diseasemedicine.disease_causecomplex mixturesInflammatory bowel diseaseAutoimmunityBiomarkerImmune systemHeat shock proteinImmunologymedicineHSP60business
researchProduct

THE COMMUNITY AS A SOURCE OF SOCIAL SUPPORT: EVALUATION AND IMPLICATIONS AT THE INDIVIDUAL AND COMMUNITY LEVELS

2006

En este trabajo se presentan tres estudios. El estudio 1 se llevó a cabo con el objetivo de explorar las propiedades psicométricas y estructura factorial del cuestionario de apoyo comunitario percibido. El estudio 2 examina la relación del apoyo comunitario con diversos indicadores del ajuste psicológico. El estudio 3 se realizó para comprobar si existen diferencias en la percepción de apoyo comunitario entre participantes de áreas residenciales normales y de alto riesgo. Los resultados confirman que la percepción de apoyo comunitario está relacionada positivamente con en el ajuste psicológico, así como que las condiciones de la comunidad de residencia influyen en la percepción de apoyo com…

apoyo socialapoyo comunitariointegración socialajuste psicológico.community supportsocial integrationsocial supportpsychological adjustment.
researchProduct

Rituals During Lockdown : The "Clap for our Carers" Phenomenon in France

2020

The article will analyse the emergence of the applause for health workers to health personnel, a practice widespread in France since the first day of lockdown. We examine the meaning of this ritual that was first promoted on the web and then adopted by the social actors themselves in the semi-private space of windows and balconies. We will investigate the relationships and the meaning of this practice both on the web and in the social space.

applauserituallcsh:Sociology (General)[SHS.INFO]Humanities and Social Sciences/Library and information scienceslcsh:HM401-1281community[SHS] Humanities and Social Sciences16. Peace & justiceComputingMilieux_MISCELLANEOUS[SHS.INFO] Humanities and Social Sciences/Library and information sciencesclap for our carers[SHS]Humanities and Social SciencesCulture e Studi del Sociale
researchProduct

Original data for manuscript: Quantity and Quality of Aquaculture Enrichments Influence Disease Epidemics and Provide Ecological Alternatives to Anti…

2021

The data processed and analyzed in this study are given in a single file: Karvonen et al. exposure data.xlsx. For detailed description of the material, methods and results of the study, see the article.

aquaculturedisease epidemiologyenriched rearingloisetSalmo salarSalmo truttamicrobial communityparasitesenvironmental microbesbiofilm
researchProduct

Interprétariat juridique en Finlande et autorité en matière de langage : savoir linguistique et pouvoir discursif

2014

asioimistulkkausoikeustulkkausmonikielisyyscommunity interpreting
researchProduct

La participación educativa de las familias en una escuela pública valenciana : un estudio cualitativo

2016

Resumen basado en el de la publicación Monográfico con el título Enseñanza superior en Europa : objetivos contemporáneos para instituciones históricas Título, resumen y palabras clave en español e inglés Se analiza desde la reflexión política y crítica la participación activa de las familias, un estudio de campo en una escuela pública del municipio de Carcaixent (Valencia) sobre las diferentes percepciones, reflexiones e impresiones del profesorado, equipo directivo, Asociación de Madres y Padres (AMPA) y familias de dicho centro educativo. Gracias a una serie de entrevistas semi-estructuradas, la transcripción de las mismas y el posterior análisis de contenido, hemos obtenido valiosas conc…

asociación de padresEducational communityField (Bourdieu)Learning communityEducationActive participationPoliticsparticipación de los padrespolítica de la educaciónPedagogySociologyValenciaCritical reflectionQualitative research
researchProduct

Negotiating informal housing in Metro Manila : forging communities through participation

2016

This research project examines socialized housing programs available to informal settlers in the megacity of Metro Manila, Philippines, and the socio-political and institutional relationships that enable or impede access to housing. Megacities are urban agglomerations with populations of over 10 million inhabitants and Asia and Africa contain some of the fastest growing cities in the world. The challenge of Southern governments to meet the housing needs of hundreds of thousands of urban poor is exacerbated by the influx of migrants into these economic hubs, the scarcity of land for low-income housing and the inequalities and infrastructure deficiencies in developing countries’ cities. The s…

asuinyhteisötsocial preparationMetro ManilayhteisöasuminenpovertymegacitiespaikallisyhteisötasuminenManilasuurkaupungitosallistamineninformal housingcommunityparticipationtalonvaltausFilippiinitviranomaisetperheetasuntopolitiikkaprofessional squattersinformal settlersvalues formationköyhyyskansalaisjärjestöt
researchProduct