0000000000093357

AUTHOR

Timo Rantalainen

showing 129 related works from this author

Differential Effects of Exercise on Tibial Shaft Marrow Density in Young Female Athletes

2013

Increased mechanical loading can promote the preferential differentiation of bone marrow mesenchymal stem cells to osteoblastogenesis, but it is not known whether long-term bone strength-enhancing exercise in humans can reduce marrow adiposity.Our objective was to examine whether bone marrow density (MaD), as an estimate of marrow adiposity 1) differs between young female athletes with contrasting loading histories and bone strengths and 2) is an independent predictor of bone strength at the weight-bearing tibia.Mid-tibial MaD, cortical area (CoA), total area, medullary area, strength strain index (SSI), and cortical volumetric bone mineral density (vBMD) (total, endocortical, midcortical, …

Adultmedicine.medical_specialtyAdolescentChemical PhenomenaMedullary cavityEndocrinology Diabetes and MetabolismAdipocytes WhiteClinical BiochemistryBone Marrow CellsContext (language use)BiochemistryWeight-BearingYoung AdultEndocrinologyBone DensityBone MarrowOsteogenesisInternal medicinemedicineHumansTibiaQuantitative computed tomographyExerciseAdiposityBone mineralOsteoblastsTibiabiologymedicine.diagnostic_testAthletesbusiness.industryBiochemistry (medical)Adolescent Developmentbiology.organism_classificationPeripheralEndocrinologymedicine.anatomical_structureAthletesFemaleDiaphysesBone marrowTomography X-Ray ComputedbusinessThe Journal of Clinical Endocrinology & Metabolism
researchProduct

Vertical ground reaction force measurements and video measurements provide comparable estimates of distance moved by mice during artificial light and…

2011

Video-based measures of spontaneous activity of rodents are of interest in studying, e.g. physiology. However, video-based tracking methods typically require light. The purpose of the present study was to develop a video based method for tracking movements of mice during a dark period. The method was applied in comparing the dark and light period activities of mice. Ten male mice were used in the present study. The activity of the animals was monitored simultaneously with video and ground reaction force (GRF) recordings during consecutive 12h periods of artificial light and dark. Texture based background subtraction method was used to track the mouse from the video recording, while the weig…

PhysicsMaleBackground subtractionArtificial lightLightbusiness.industryGeneral NeuroscienceMovementVertical ground reaction forceVideo RecordingMale miceDarknessMotor ActivityTracking (particle physics)GeodesyDark periodBiomechanical PhenomenaCircadian RhythmWeight-BearingMiceOpticsAnimalsGround reaction forcebusinessVideo basedJournal of neuroscience methods
researchProduct

The skeletal maturity of Australian children aged 10-13 years in 2016.

2021

Skeletal maturity can be used as a biological indicator of the tempo of growth in children and adolescents. We present a description of skeletal maturity from a cohort of white Australian children and describe variation in skeletal maturity based on child age. Participants (n = 71; age 10.5-13.9 years) were recruited from the 'Healthy, Active Preschool & Primary Years (HAPPY)' study. Left hand-wrist radiographs were used to determine skeletal maturity using the Tanner-Whitehouse III (TW3) RUS technique. In boys, the mean skeletal maturity offset (bone age - chronological age) was -0.12 ± 0.19 years and 57.9% had delayed skeletal maturity compared to chronological age. Among those with delay…

MaleAgingAdolescentPhysiologyEpidemiologyChild ageContext (language use)Cohort StudiesGeneticsMedicineHumansChildSkeletonBone Developmentbusiness.industryPublic Health Environmental and Occupational HealthAustraliaBone ageChronological ageSkeletal maturityDelayed skeletal maturationCohortFemalebusinessCohort studyDemographyAnnals of human biology
researchProduct

Innervation zone shift at different levels of isometric contraction in the biceps brachii muscle

2007

Experiments were carried out to examine whether innervation zone (IZ) location remains stable at different levels of isometric contraction in the biceps brachii muscle (BB), and to determine how the proximity of the IZ affects common surface electromyography (sEMG) parameters. Twelve subjects performed maximal (MVC) and submaximal voluntary isometric contractions at 10%, 20%, 30%, 40%, 50% and 75% of MVC. sEMG signals were recorded with a 13 rows x 5 columns grid of electrodes from the short head of BB. The IZ shifted in the proximal direction by up to 2.4 cm, depending upon the subject and electrode column. The mean shift of all the columns was 0.6+/-0.4 cm (10% vs. 100% MVC, P0.001). This…

AdultMalemedicine.diagnostic_testBiceps brachii muscleElectromyographyChemistryPhysical ExertionBiophysicsNeuroscience (miscellaneous)Reproducibility of ResultsIsometric exerciseElectromyographyAnatomyMuscle fiber conduction velocitySensitivity and SpecificityIsometric ContractionElbow JointPhysical EndurancemedicineHumansNeurology (clinical)Muscle SkeletalElectrodesJournal of Electromyography and Kinesiology
researchProduct

The Associations of Activity Fragmentation with Physical and Mental Fatigability among Community-Dwelling 75-, 80- and 85-Year-Old People

2020

Abstract Background Fatigue related to task standardized by duration and intensity, termed fatigability, could manifest as shortening of activity bouts throughout the day causing daily activity to accumulate in a more fragmented pattern. Our purpose was to study the association of activity fragmentation with physical and mental dimensions of fatigability. Methods A cross-sectional study of 485 community-dwelling 75-, 80-, and 85-year-old people using a thigh-worn accelerometer for 3–7 days. Activity fragmentation was studied as Active-to-Sedentary Transition Probability for 2 operational definitions of physical activity: accelerations equivalent to at least light physical activity and for u…

MaleAgingmedicine.medical_specialtyCross-sectional studyMental fatigueväsymysPhysical ExertionPhysical activityphysical activityWalkingliikunta03 medical and health sciencesadaptive strategies0302 clinical medicinePhysical medicine and rehabilitationhenkinen hyvinvointiSurveys and QuestionnairesAccelerometryHumansMedicine030212 general & internal medicineExertionExercise physiologyExerciseFatigueAgedbusiness.industryFragmentation (computing)Physical activity levelactivity patternsCross-Sectional StudiesPhysical FatigueFemalefatigueIndependent LivingGeriatrics and Gerontologybusinessfyysinen hyvinvointi030217 neurology & neurosurgeryfyysinen aktiivisuusikääntyneet
researchProduct

Short-interval intracortical inhibition is not affected by varying visual feedback in an isometric task in biceps brachii muscle

2013

Short-interval intracortical inhibition (SICI) of the primary motor cortex (M1) appears to play a significant role in skill acquisition. Consequently, it is of interest to find out which factors cause modulation of SICI. Purpose: To establish if visual feedback and force requirements influence SICI. Methods: SICI was assessed from 10 healthy adults (5 males and 5 females aged between 21 and 35 years) in three submaximal isometric elbow flexion torque levels (5%, 20% and 40% of maximal voluntary contraction [MVC]) and with two tasks differing in terms of visual feedback. Single-pulse and paired-pulse motor evoked potentials (MEPs), supramaximal M-wave and background surface electromyogram (s…

medicine.medical_specialtymedicine.medical_treatmenttranskraniaalinen magnettistimulaatioprimäärinen aivokuoriIsometric exerciseta3112lcsh:RC321-571Task (project management)Behavioral NeurosciencePhysical medicine and rehabilitationmotor controlmedicineOriginal Research Articleta315lcsh:Neurosciences. Biological psychiatry. NeuropsychiatrytehtäväspesifisyysBiological Psychiatryvoiman säätelymotorinen kontrolliprimary motor cortexForce gradationBiceps brachii musclebusiness.industrytranskraniaalinen magneettistimulaatioRepeated measures designMotor controlta3141Transcranial Magnetic StimulationTranscranial magnetic stimulationforce gradationPsychiatry and Mental healthNeuropsychology and Physiological PsychologyNeurologyPhysical therapyIntracortical inhibitiontask specificityPrimary motor cortexbusinessNeuroscienceFrontiers in Human Neuroscience
researchProduct

Neuromuscular performance and body mass as indices of bone loading in premenopausal and postmenopausal women.

2009

The strong association between body mass and skeletal robusticity has been attributed to increasing skeletal loading with increasing mass. However, it is unclear whether body mass is merely a coarse substitute for bone loading rather than a true independent predictor of bone strength. As indices of neuromuscular performance, impulse and peak power were determined from vertical ground reaction force during a maximal counter movement jump test in 221 premenopausal and 82 postmenopausal women. Bone compressive (BSI(d) g(2)/cm(4)) and bending (SSImax(mid) mm(3)) strength indices were measured with peripheral quantitative computed tomography (pQCT) at the distal ((d)) and midshaft ((mid)) sites …

Adultmedicine.medical_specialtyHistologyCompressive StrengthPhysiologyEndocrinology Diabetes and MetabolismMovementPhysical Exertion030209 endocrinology & metabolismIndependent predictorWeight-Bearing03 medical and health sciences0302 clinical medicineBone strengthBone loadingWeight lossOsteoarthritisMedicineHumansTibiaMuscle StrengthQuantitative computed tomography030304 developmental biologyOrthodontics0303 health sciencesHip fracturePostmenopausal womenmedicine.diagnostic_testTibiabusiness.industryBody WeightAge FactorsMiddle Agedmedicine.diseaseSurgeryPostmenopauseRadiographyPremenopauseBody CompositionRegression AnalysisFemaleStress Mechanicalmedicine.symptombusinessMuscle ContractionBone
researchProduct

Association Between Free-Living Sit-to-Stand Transition Characteristics, and Lower-Extremity Performance, Fear of Falling, and Stair Negotiation Diff…

2022

Abstract Background Good sit-to-stand (STS) performance is an important factor in maintaining functional independence. This study investigated whether free-living STS transition volume and intensity, assessed by a thigh-worn accelerometer, is associated with characteristics related to functional independence. Methods Free-living thigh-worn accelerometry was recorded continuously for 3–7 days in a population-based sample of 75-, 80-, and 85-year-old community-dwelling people (479 participants; women n = 287, men n = 192). The records were used to evaluate the number and intensity (angular velocity of the STS phase) of STS transitions. Associations with short physical performance battery (SPP…

Aged 80 and overMalekaatuminenAgingNegotiatinggeriatric assessmentfyysinen toimintakykyFearphysical performancemittausmenetelmätphysical functionfunctional performanceHumansFemaleKneeIndependent LivingGeriatrics and Gerontologychair riseikääntyneetAged
researchProduct

36 Altered Prefrontal Cortex Responses in Older Adults with Subjective Memory Complaints and Dementia During Dual-Task Gait: An Fnirs Study

2019

Abstract In this study, we investigated the effects of walking during single-task and dual-task gait (STG and DTG) conditions, on left prefrontal cortex (LPFC) activation in older adults with subjective memory complaints (SMC) and Dementia. A total of 72 older adults (aged 65-94 yrs; 33 Healthy; 28 SMC; 11 Dementia) were recruited from the community and assisted living facilities. A portable 7m zeno walkway gait analysis mat was used to measure stride, velocity, length and duration during 4 passes of STG and DTG each. A portable single-channel functional near-infrared spectroscopy (fNIRS) device (Portalite, Artinis Medical Systems) was placed over the LPFC to measure changes in oxyhaemoglob…

Agingmedicine.medical_specialtybusiness.industryGeneral MedicineSubjective memoryDUAL (cognitive architecture)medicine.diseaseTask (project management)Physical medicine and rehabilitationGait (human)medicineDementiaGeriatrics and GerontologybusinessPrefrontal cortexAge and Ageing
researchProduct

Children’s physical activity and sedentary time compared using assessments of accelerometry counts and muscle activity level

2018

Background This research compared accelerometry (ACC)-derived and muscle electromyography (EMG)-based estimates of physical activity (PA) and sedentary time in typical PA tasks and during the daily lives of children. Methods Data was included from two exploratory studies. In Study I, 6–7-year-old children (n = 11, 64% girls) were assessed for eight PA tasks (walking, stair negotiation, climbing, crawling, swinging, balancing, trampoline jumping and a game of tag). In Study II, 7–9-year-old children (n = 14, 38% girls) were assessed for six PA tasks (walking, sitting, static squat, single leg hops, jump for height and standing long jump), and daily PA during one day with and one day without…

medicine.medical_specialtyelectromyographyActivities of daily livingsedentary timelcsh:Medicine030209 endocrinology & metabolismSquatlapset (ikäryhmät)ElectromyographySittingmedicine.disease_causeGeneral Biochemistry Genetics and Molecular Biology03 medical and health sciences0302 clinical medicineJumpingPhysical medicine and rehabilitationMedicineta315young childrenmuscle activitymedicine.diagnostic_testlihasaktiivisuusbusiness.industryGeneral Neurosciencejoutilaisuuslcsh:R030229 sport sciencesGeneral MedicineKinesiologymittausmenetelmätbody regionsaccelerometerelektromyografiainactivityClimbingTrampolinePublic HealthGeneral Agricultural and Biological Sciencesbusinesshuman activitiesHamstringfyysinen aktiivisuusPeerJ
researchProduct

Day-to-Day Variability and Year-to-Year Reproducibility of Accelerometer-Measured Free-Living Sit-to-Stand Transitions Volume and Intensity among Com…

2021

(1) Background: The purpose of this study was to evaluate the day-to-day variability and year-to-year reproducibility of an accelerometer-based algorithm for sit-to-stand (STS) transitions in a free-living environment among community-dwelling older adults. (2) Methods: Free-living thigh-worn accelerometry was recorded for three to seven days in 86 (women n = 55) community-dwelling older adults, on two occasions separated by one year, to evaluate the long-term consistency of free-living behavior. (3) Results: Year-to-year intraclass correlation coefficients (ICC) for the number of STS transitions were 0.79 (95% confidence interval, 0.70-0.86, p < 0.001), for mean angular velocity-0.81 (95% c…

TechnologyACCURACYTP1-1185mobility limitationEngineeringAGEAccelerometryHumansKINEMATICSInstruments & InstrumentationAgedScience & TechnologyChemical technologyCommunicationDISABILITYMORTALITYChemistry AnalyticalReproducibility of ResultsliikuntarajoitteetEngineering Electrical & Electronictest-retestmittausmenetelmätChemistryLOWER-EXTREMITY FUNCTIONPHYSICAL-ACTIVITYThighPhysical SciencesYOUNGFemaleIndependent LivingTEST-RETEST RELIABILITYBODY FIXED SENSORchair risetest–retestfyysinen aktiivisuusikääntyneet
researchProduct

Validation of a method to measure total spontaneous physical activity of sedentary and voluntary running mice

2014

Running wheels are commonly used to stimulate physical activity of mice. To control the effects of physical activity on study results, it is important to measure the total activity (all movements) of both sedentary and running wheel stimulated mice.Because there was a lack of a validated system, we built a force-plate based system specifically for this purpose. The validity of the system and its variables (activity index, activity time and distance) were tested in calibration measurements and in situ by measuring the activity of eight mice both with and without running wheels. Four mice served as sedentary controls. Activity index adds changes in vertical reaction forces induced by moving m…

Total physical activityMaleVolitionTime FactorsGeneral NeurosciencePhysical activityEquipment DesignActivity indexMotor ActivityActigraphyHousing AnimalRunningMice Inbred C57BLAnimal scienceTurnoverWheel runningActivity timeCalibrationAnimalsta315SimulationMathematicsJournal of Neuroscience Methods
researchProduct

Voluntary Running Aids to Maintain High Body Temperature in Rats Bred for High Aerobic Capacity

2016

The production of heat, i.e., thermogenesis, is a significant component of the metabolic rate, which in turn affects weight gain and health. Thermogenesis is linked to physical activity (PA) level. However, it is not known whether intrinsic exercise capacity, aging, and long-term voluntary running affect core body temperature. Here we use rat models selectively bred to differ in maximal treadmill endurance running capacity (Low capacity runners, LCR and High capacity Runners, HCR), that as adults are divergent for aerobic exercise capacity, aging, and metabolic disease risk to study the connection between PA and body temperature. Ten high capacity runner (HCR) and ten low capacity runner (L…

0301 basic medicinemedicine.medical_specialtyAgingPhysiologyphysical activitylcsh:PhysiologyBody Temperatureruumiinlämpö03 medical and health sciencesGastrocnemius muscle0302 clinical medicinePhysiology (medical)Internal medicinemedicineAerobic exerciseTreadmillskeletal muscleta315Aerobic capacityOriginal ResearchCore (anatomy)lcsh:QP1-981business.industryagingSkeletal muscleta3141aerobic capacity030104 developmental biologyEndocrinologymedicine.anatomical_structurePhysical therapyaerobinen suorituskykymedicine.symptombusinesshuman activitiesThermogenesisWeight gain030217 neurology & neurosurgeryFrontiers in Physiology
researchProduct

The gait is less stable in children with cerebral palsy in normal and dual-task gait

2020

medicine.medical_specialtyGait (human)Physical medicine and rehabilitationbusiness.industryRehabilitationBiophysicsMedicineOrthopedics and Sports MedicineDUAL (cognitive architecture)businessmedicine.diseaseTask (project management)Cerebral palsyGait &amp; Posture
researchProduct

Effects of a progressive aquatic resistance exercise program on the biochemical composition and morphology of cartilage in women with mild knee osteo…

2013

Background Symptoms associated with osteoarthritis of the knee result in decreased function, loss of working capacity and extensive social and medical costs. There is a need to investigate and develop effective interventions to minimise the impact of and even prevent the progression of osteoarthritis. Aquatic exercise has been shown to be effective at reducing the impact of osteoarthritis. The purpose of this article is to describe the rationale, design and intervention of a study investigating the effect of an aquatic resistance exercise intervention on cartilage in postmenopausal women with mild knee osteoarthritis. Methods A minimum of 80 volunteers who meet the inclusion criteria will b…

Cartilage ArticularTime FactorsAquatic exerciseKnee JointSports medicineContrast MediaOsteoarthritisNORMAL HYALINE CARTILAGEKnee JointSeverity of Illness Indexlaw.inventionStudy ProtocolAbsorptiometry PhotonSwimming Pools0302 clinical medicineRandomized controlled triallawSurveys and QuestionnairesImmersionOrthopedics and Sports Medicine10. No inequalityFinlandPain MeasurementAUTOLOGOUS CHONDROCYTE TRANSPLANTATIONmedicine.diagnostic_testMiddle AgedOsteoarthritis KneeMagnetic Resonance ImagingBiomechanical Phenomena3. Good healthPostmenopauseTreatment OutcomeResearch DesignBody CompositionFemaleT-2 RELAXATION-TIMEELDERLY-WOMENmedicine.medical_specialtydGEMRICMIDDLE-AGED ADULTSeducationGADOLINIUM-ENHANCED MRIPhysical examination03 medical and health sciencesRheumatologyPredictive Value of TestsInternal medicineSeverity of illnessOsteoarthritismedicineHumansMODERATE RUNNING EXERCISET2 relaxation timeEVIDENCE-BASED RECOMMENDATIONSBonePhysical ExaminationAged030203 arthritis & rheumatologybusiness.industryResistance Training030229 sport sciencesQuantitative MRIARTICULAR-CARTILAGEmedicine.disease3126 Surgery anesthesiology intensive care radiologyRheumatologyOrthopedic surgeryPhysical therapyLAND-BASED EXERCISETomography X-Ray Computedbusiness
researchProduct

Neuromuscular mechanics and hopping training in elderly.

2014

Purpose The present study examined the effects of repetitive hopping training on muscle activation profiles and fascicle–tendon interaction in the elderly. Methods 20 physically active elderly men were randomly assigned for training (TG) and control groups (CG). TG performed supervised bilateral short contact hopping training with progressively increasing training volume. Measurements were performed before the training period (BEF) as well as after 2 weeks (2 W) and 11 weeks (11 W) of training. During measurements, the gastrocnemius medialis–muscle (GaM) fascicle and its outer Achilles tendon length changes during hopping were examined by ultrasonography together with electromyographic (EMG…

Gastrocnemius medialisMalemedicine.medical_specialtyPhysiologystretch–shortening cycleeducationElectromyographymedicine.disease_causeAchilles TendonStretch shortening cyclejänteetJumpingPhysical medicine and rehabilitationPhysiology (medical)MedicineHumansOrthopedics and Sports MedicineMuscle SkeletalExerciseAgedAchilles tendonmedicine.diagnostic_testbusiness.industryElectromyographyagingPublic Health Environmental and Occupational HealthultraääniGeneral MedicineFascicleTendonBiomechanical Phenomenaelektromyografiamedicine.anatomical_structureJoint stiffnessmedicine.symptomAnklebusinessAnkle JointMuscle ContractionEuropean journal of applied physiology
researchProduct

Increased Joint Mobility Is Associated With Impaired Transversus Abdominis Contraction.

2020

Mitchell, UH, Owen, PJ, Rantalainen, T, and Belavý, DL. Increased joint mobility is associated with impaired transversus abdominis contraction. J Strength Cond Res 36(9): 2472-2478, 2022-Increased joint mobility is a risk factor for joint injury, but muscle function may be able to compensate for it. Current evidence suggests reduced force production capacity in people with hypermobility. However, little is known about the lumbar spine. The purpose of this cross-sectional study was to assess whether there was a link between joint mobility and transverse abdominis and multifidus muscles contraction, muscles ascribed a core-stability role. Using a modified quantitative version of the Beighton …

medicine.medical_specialtyContraction (grammar)medicine.diagnostic_testbusiness.industryParaspinal MusclesPhysical Therapy Sports Therapy and RehabilitationMagnetic resonance imagingGeneral MedicineMiddle AgedLow back painTrunkMultifidus musclePhysical medicine and rehabilitationCross-Sectional StudiesStatistical significanceMedicineHumansOrthopedics and Sports MedicineTransversus abdominismedicine.symptomIncreased joint mobilitybusinessLow Back PainAbdominal MusclesMuscle ContractionJournal of strength and conditioning research
researchProduct

Associations of age, body size, and maturation with physical activity intensity in different laboratory tasks in children.

2021

We investigated the associations of age, sex, body size, body composition, and maturity with measures of physical activity (PA) intensity in children. PA intensity was assessed using VO2 as % of VO...

MaleAnaerobic Thresholdmedia_common.quotation_subjectPhysical activityPhysical Therapy Sports Therapy and RehabilitationBody sizeBiologyAnimal scienceOxygen ConsumptionSex FactorsAccelerometryTask Performance and AnalysisBody SizeHumansOrthopedics and Sports MedicineSexual MaturationChildMuscle SkeletalExercisemedia_commonElectromyographyAge FactorsBody HeightMaturity (psychological)Intensity (physics)Body CompositionFemaleEnergy MetabolismJournal of sports sciences
researchProduct

ASSOCIATION BETWEEN LEISURE TIME PHYSICAL ACTIVITY LEVEL AND ARTICULAR CARTILAGE IN POSTMENOPAUSAL WOMEN WITH MILD KNEE OSTEOARTHRITIS: A 12-MONTH FO…

2016

030203 arthritis & rheumatologymedicine.medical_specialtyPostmenopausal womenbusiness.industryLeisure timeBiomedical EngineeringArticular cartilageOsteoarthritismedicine.diseasePhysical activity level03 medical and health sciences0302 clinical medicineRheumatologyIntervention (counseling)medicinePhysical therapyOrthopedics and Sports MedicinebusinessMonth follow up
researchProduct

Development of a Parkinson’s disease specific falls questionnaire

2020

Abstract Background Falls are a major health burden for older adults with Parkinson’s disease (PD), but there is currently no reliable questionnaire to capture the circumstances and consequences of falls in older adults with PD. This study aimed to develop a PD-specific falls questionnaire and to evaluate its test-retest reliability in older adults with PD. Methods A novel PD-specific falls questionnaire (PDF-Q) was developed in two modes (online and paper-based version) and used to assess falls and near-falls events over the past 12-months. Questions were agreed upon by an expert group, with the domains based on previous falls-related questionnaires. The questions included the number and c…

medicine.medical_specialtykyselytutkimusFalls in older adultsParkinsonin tautinear-fallsSurveys and QuestionnairesNear-fallsfallsMedicineHumansAgedreliabiliteettikaatuminenreliabilityMedical treatmentGeriatrics gerontologybusiness.industryQuestionnaireResearchquestionnaireRC952-954.6Reproducibility of ResultsParkinson DiseaseReliabilityExpert groupGeriatricsPhysical therapyParkinson’s diseaseFallsGeriatrics and GerontologybusinessikääntyneetBMC Geriatrics
researchProduct

Comments on the article titled ‘Component mode synthesis approach to estimate tibial strains in gait’,Journal of Medical Engineering &amp; Technology…

2011

In a recent article published in the Journal of Medical Engineering & Technology, Gaofeng et al. [1] claimed that they were the first to propose the flexible multibody simulation approach (i.e. flo...

MaleEngineering drawingEngineeringTibiabusiness.industryBiomedical EngineeringMultibody simulationGeneral MedicineGait (human)Mode (computer interface)Component (UML)HumansArtificial intelligencebusinessGaitGeneralLiterature_REFERENCE(e.g.dictionariesencyclopediasglossaries)SkeletonJournal of Medical Engineering &amp; Technology
researchProduct

The gait is less stable in children with cerebral palsy in normal and dual-task gait compared to typically developed peers

2021

There is limited evidence about gait stability and its alteration by concurrent motor and cognitive tasks in children with cerebral palsy (CP). We examined gait stability and how it is altered by constrained cognitive or motor task in CP and their typically developed (TD) controls. Gait kinematics were recorded using inertial-measurement units (IMU) from 18 patients with hemiplegia (13.5 +/- 2.4 years), 12 with diplegia (13.0 +/- 2.1 years), and 31 TD controls (13.5 +/- 2.2 years) during unconstrained gait, and motor (carrying a tray) and cognitive (word naming) task constrained gait at preferred speed (similar to 400 steps/task). Step duration, its standard deviation and refined-compound-m…

CP-oireyhtymämedicine.medical_specialtyElementary cognitive taskKinematics0206 medical engineeringtasapainoBiomedical EngineeringBiophysicslapset (ikäryhmät)02 engineering and technologyKinematicsWalkingTask (project management)Cerebral palsy03 medical and health sciences0302 clinical medicinePhysical medicine and rehabilitationGait (human)3123 Gynaecology and paediatricsmedicineHumansOrthopedics and Sports MedicineAttentionChildGaitGait Disorders Neurologicliikeoppibusiness.industryCerebral PalsyCP-vammaisetRehabilitationDiplegiaGait variabilityCognitionmedicine.disease020601 biomedical engineeringBiomechanical PhenomenakävelyMotor taskInertial measurement unitCase-Control Studiesbiomekaniikkavakaus (fysiikka)businesshuman activitiesStability030217 neurology & neurosurgery
researchProduct

Flexible multibody simulation approach in the analysis of tibial strain during walking.

2007

Strains within the bone tissue play a major role in bone (re)modeling. These small strains can be assessed using experimental strain gage measurements, which are challenging and invasive. Further, the strain measurements are, in practise, limited to certain regions of superficial bones only, such as the anterior surface of the tibia. In this study, tibial strains occurring during walking were estimated using a numerical approach based on flexible multibody dynamics. In the introduced approach, a lower body musculoskeletal model was developed by employing motion capture data obtained from walking at a constant velocity. The motion capture data were used in inverse dynamics simulation to teac…

AdultMaleModels AnatomicComputer scienceBiomedical EngineeringBiophysicsWalkingBone tissueMotion captureInverse dynamicsWeight-BearingImaging Three-DimensionalmedicineHumansOrthopedics and Sports MedicineComputer SimulationTibiaStrain gaugeTibiabusiness.industryRehabilitationDynamics (mechanics)Multibody simulationStructural engineeringMultibody systemBiomechanical Phenomenamedicine.anatomical_structureStress MechanicalbusinessJournal of biomechanics
researchProduct

Associations Between Accelerometer-Based Free-Living Walking and Self-Reported Walking Capability Among Community-Dwelling Older People

2021

The authors examined whether accelerometer-based free-living walking differs between those reporting walking modifications or perceiving walking difficulty versus those with no difficulty. Community-dwelling 75-, 80-, or 85-year-old people (N = 479) wore accelerometers continuously for 3–7 days, and reported whether they perceived no difficulties, used walking modifications, or perceived difficulties walking 2 km. Daily walking minutes, walking bouts, walking bout intensity and duration, and activity fragmentation were calculated from accelerometer recordings, and cut points for increased risk for perceiving walking difficulties were calculated using receiver operating characteristic analys…

medicine.medical_specialtyPhysical Therapy Sports Therapy and RehabilitationWalkingAccelerometercompensation03 medical and health sciences0302 clinical medicinePhysical medicine and rehabilitationAccelerometryliikuntakykymedicineHumans030212 general & internal medicineMobility Limitationwalking accumulationAgedAged 80 and overReceiver operating characteristic analysisRehabilitation030229 sport sciencesmobilitykävelyIncreased riskDifficulty walkingIndependent LivingSelf ReportGeriatrics and GerontologyOlder peoplePsychologyhuman activitiesGerontologyfyysinen aktiivisuusikääntyneetJournal of Aging and Physical Activity
researchProduct

Quantification of Recruit Training Demands and Subjective Wellbeing during Basic Military Training

2022

Purpose: Assess and describe the physical demands and changes in subjective wellbeing of recruits completing the 12 week Australian Army Basic Military Training (BMT) course. Methods: Thirty-five recruits (24.8 &plusmn; 6.8 y; 177.4 &plusmn; 10.1 cm, 75.6 &plusmn; 14.7 kg) consented to daily activity monitoring and weekly measures of subjective wellbeing (Multi-component Training Distress Scale, MTDS). The physical demands of training were assessed via wrist worn activity monitors (Actigraph GT9X accelerometer). Physical fitness changes were assessed by push-ups, sit-ups and multi-stage shuttle run in weeks 2 and 8. Results: All objective and subjective measures significantly changed (p &lt…

Health Toxicology and MutagenesisPublic Health Environmental and Occupational HealthAustraliamonitorointisotilaskoulutusself-reportfyysinen kuormittavuusrecruitsoldiermonitoringfyysinen kuntoMilitary PersonnelPhysical FitnessHumansarmysoldier; army; self-report; monitoring; recruit; allostatic loadkoettu hyvinvointialokkaatallostatic loadUncategorized
researchProduct

Markerless 2D kinematic analysis of underwater running : A deep learning approach

2018

Kinematic analysis is often performed with a camera system combined with reflective markers placed over bony landmarks. This method is restrictive (and often expensive), and limits the ability to perform analyses outside of the lab. In the present study, we used a markerless deep learning-based method to perform 2D kinematic analysis of deep water running, a task that poses several challenges to image processing methods. A single GoPro camera recorded sagittal plane lower limb motion. A deep neural network was trained using data from 17 individuals, and then used to predict the locations of markers that approximated joint centres. We found that 300–400 labelled images were sufficient to tra…

QA75Motion analysisComputer scienceQP301.H75_Physiology._Sport.0206 medical engineeringBiomedical EngineeringBiophysicsVideo RecordingSTRIDEImage processing02 engineering and technologyKinematicstekoälySports biomechanicsRunning03 medical and health sciencesMotion0302 clinical medicineImmersionImage Processing Computer-AssistedHumansOrthopedics and Sports MedicineComputer visionliikeanalyysita315liikeoppiGV557_SportsArtificial neural networkPixelbusiness.industryDeep learningmotion analysisRehabilitationvesijuoksuReproducibility of Resultsdeep learningdeep water runningartificial intelligence020601 biomedical engineeringBiomechanical PhenomenaLower ExtremitykinematicsArtificial intelligenceNeural Networks Computerbusiness030217 neurology & neurosurgeryJournal of Biomechanics
researchProduct

Individual Scaling of Accelerometry to Preferred Walking Speed in the Assessment of Physical Activity in Older Adults

2020

Abstract Background Walking forms a large portion of physical activity (PA) of older adults. We assessed free-living PA using acceleration corresponding to preferred walking speed as a relative cut-point and studied how it relates to age. We compared the relative cut-point to a common absolute cut-point of moderate-to-vigorous physical activity (MVPA). Method Four hundred forty-four community-dwelling adults aged 75, 80, and 85 years wore an accelerometer on the thigh during a PA surveillance period and a modified 6-minute walking test (6MWT) at preferred speed. Each individual’s mean acceleration (g) during the 6MWT was used as a cut-point for relative PA. Acceleration corresponding to thr…

MaleAgingmedicine.medical_specialtyPhysical activityAccelerometerMetabolic equivalent03 medical and health sciencesexercise intensity0302 clinical medicinePhysical medicine and rehabilitationcut-pointAccelerometrymedicineHumans030212 general & internal medicineExercise physiologyExerciseAgedsuorituskykyAged 80 and overbusiness.industrymittausaktiivisuusrannekeAge Factorsphysical performance030229 sport scienceskävelyWalking SpeedIntensity (physics)Preferred walking speedaccelerometerCross-Sectional StudiesExercise intensityFemaleGeriatrics and Gerontologybusinesshuman activitiesikääntyneetfyysinen aktiivisuusCut-pointThe Journals of Gerontology: Series A
researchProduct

High intensity aquatic exercise or daily physical activity for maintaining fat mass and walking ability for postmenopausal women with knee osteoarthr…

2016

030203 arthritis & rheumatology030222 orthopedicsmedicine.medical_specialtyPostmenopausal womenbusiness.industryHigh intensityPhysical activityAquatic exerciseBiomedical EngineeringOsteoarthritismedicine.diseaseFat mass03 medical and health sciences0302 clinical medicineRheumatologyPhysical therapymedicineOrthopedics and Sports MedicinebusinessOsteoarthritis and Cartilage
researchProduct

Axial loading and posture cues in contraction of transversus abdominis and multifidus with exercise

2020

AbstractAstronauts are at increased risk of spine injury. With a view to developing training approaches for the muscles of the spine in microgravity, this study examined the effects of axial loading and postural cues on the contraction of transversus abdominis and lumbar multifidus in supine lying using a novel exercise device (GravityFit). Thirty (18 males and 12 females) endurance-trained runners without a history of spinal pain aged 33–55 years were recruited. Magnetic resonance imaging (MRI) was performed under one rest and five exercise conditions, which involved variations in axial loading and postural cues. Whole volume of the abdominal and lumbar paraspinal muscles was imaged and tr…

AdultMaleContraction (grammar)Supine positionPhysiologyPostureParaspinal Muscleslcsh:MedicinelihaksetArticleWeight-Bearing03 medical and health sciences0302 clinical medicineLumbarselkärankamedicineHumansTransversus abdominislcsh:Sciencespine injuryAbdominal MusclesMultidisciplinaryMusculoskeletal systemmedicine.diagnostic_testbusiness.industryWeightlessnesslcsh:RMagnetic resonance imaging030229 sport sciencesAnatomyMiddle AgedSpinal painSpinal InjuriesSpine injurylcsh:QFemalebiomekaniikkavoimaharjoittelumedicine.symptombusiness030217 neurology & neurosurgeryMuscle contractionMuscle ContractionPhysical Conditioning Human
researchProduct

Predicting the age at natural menopause in middle-aged women

2021

Objective To predict the age at natural menopause (ANM). Methods Cox models with time-dependent covariates were utilized for ANM prediction using longitudinal data from 47 to 55-year-old women (n = 279) participating in the Estrogenic Regulation of Muscle Apoptosis study. The ANM was assessed retrospectively for 105 women using bleeding diaries. The predictors were chosen from the set of 32 covariates by using the lasso regression (model 1). Another easy-to-access model (model 2) was created by using a subset of 16 self-reported covariates. The predictive performance was quantified with c-indices and by studying the means and standard deviations of absolute errors (MAE ± SD) between the pre…

final menstrual periodelintavatvaihdevuodetAlcohol DrinkingGeneral MathematicsConcordancemedia_common.quotation_subjectkeski-ikäkuukautiset030209 endocrinology & metabolismOriginal Studies03 medical and health sciencesMenopause prediction0302 clinical medicineSex hormone-binding globulinCovariateHumansMedicineMenopausal transitiontilastolliset mallitSocioeconomic statusMenstrual CycleMenstrual cycleProportional Hazards ModelsRetrospective Studiesmedia_commonperimenopause030219 obstetrics & reproductive medicinebiologyVasomotorbusiness.industryProportional hazards modelpremenopause.Applied Mathematicsmenopausal transitionObstetrics and GynecologyennusteetMiddle AgedPerimenopausePremenopauseHormonal contraceptionbiology.proteinFinal menstrual periodFemaleMenopausebusinessmenopause predictionDemographyMenopause
researchProduct

Comparison of Classroom-Based Sedentary Time and Physical Activity in Conventional Classrooms and Open Learning Spaces Among Elementary School Studen…

2021

European children and adolescents spend most of their daily life and especially their school hours being sedentary which may increase their risk for chronic non-communicable diseases later in life. After the curriculum reform of Finnish basic education in 2014, most of the new or renovated comprehensive schools in Finland incorporate open and flexible classroom designs. Their open learning spaces may provide students opportunities to reduce sedentary behavior during school hours. Thus, waist-worn accelerometers were used to assess classroom-based sedentary time (ST), the number of breaks from sedentary time (BST), and physical activity (PA) among cross-sectional samples of 3rd and 5th grade…

open learning spacesedentary behaviorelementary schoolGV557-1198.995classroomphysical activitybreaks from sedentary timeSportsFrontiers in Sports and Active Living
researchProduct

Age-related muscle activation profiles and joint stiffness regulation in repetitive hopping

2011

Abstract It is well documented that increasing effort during exercise is characterized by an increase in electromyographic activity of the relevant muscles. How aging influences this relationship is a matter of great interest. In the present study, nine young and 24 elderly subjects did repetitive hopping with maximal effort as well as with 50%, 65%, 75% and 90% intensities. During hopping joint kinematics were measured together with electromyographic activity (EMG) from the soleus, gastrocnemius medialis, gastrocnemius lateralis and tibialis anterior muscles. The results showed that agonist activation increased in both age groups with increasing intensity. The highest jumping efficiency (E…

AdultMaleAgonistAgingmedicine.medical_specialtymedicine.drug_classBiophysicsNeuroscience (miscellaneous)medicine.disease_causeStretch shortening cycleJumpingPhysical medicine and rehabilitationElastic ModulusmedicineHumansRange of Motion Articularta315Muscle SkeletalAgedAged 80 and overbusiness.industryMuscle activationMiddle AgedCoactivationIntensity (physics)medicine.anatomical_structureJoint stiffnessFemaleNeurology (clinical)medicine.symptomAnklebusinessAnkle JointLocomotionMuscle ContractionJournal of Electromyography and Kinesiology
researchProduct

Determining the Corticospinal Responses to Single Bouts of Skill and Strength Training

2019

Mason, J, Frazer, AK, Jaberzadeh, S, Ahtiainen, JP, Avela, J, Rantalainen, T, Leung, M, and Kidgell, DJ. Determining the corticospinal responses to single bouts of skill and strength training. J Strength Cond Res 33(9): 2299-2307, 2019-Neuroplastic changes in the primary motor cortex accompany performance improvements following motor practice. Recent evidence suggests that the corticospinal responses to strength and skill training are similar, following both a single session and repeated bouts of training, promoting discussion that strength training is a form of motor learning. However, these findings are limited by the lack of a light-load strength training group. Therefore, the aim of the…

AdultMalecorticospinal silent periodmedicine.medical_specialtyintracortical inhibitionStrength trainingmedicine.medical_treatmentneuroplasticitystrength exerciseeducationPhysical Therapy Sports Therapy and RehabilitationSensory systemliikuntaYoung AdultPhysical medicine and rehabilitationNeuroplasticityharjoitteluHumansMedicineOrthopedics and Sports MedicineNeuronal Plasticitybusiness.industrytaidotMotor CortexkortikospinaalirataResistance TrainingGeneral MedicineEvoked Potentials MotorTranscranial Magnetic StimulationTranscranial magnetic stimulationmedicine.anatomical_structureMotor SkillsIntracortical inhibitionFemalecorticospinal excitabilityvoimaharjoitteluskill trainingPrimary motor cortexbusinessMotor learningMotor cortexJournal of Strength and Conditioning Research
researchProduct

Beneficial Intervertebral Disc and Muscle Adaptations in High-Volume Road Cyclists.

2018

Purpose Cycling is widely practiced as a mode of transportation, a leisurely pursuit, and a competitive sport. Approximately half of cyclists experience low back pain. Yet, there has been limited study of spine tissue adaptations due to cycling.Methods To investigate potential risk factors for spinal pain, we compared 18 high-volume cyclists (>150 kmwk(-1) for 5 yr) to 18 height-matched nonsporting referents. Participants had no history of spinal pathology. Magnetic resonance imaging was used to quantify intervertebral disc (IVD) morphology and hydration, and psoas, erector spinae, quadratus lumborum, and multifidus muscle size and fat content. Endurance of trunk muscles (flexors and extens…

Malecyclinglihakset0302 clinical medicineRisk FactorsBack painMedicineOrthopedics and Sports MedicineCompetitive sportta315Intervertebral Discphysiological effectsGlycosaminoglycansPsoas Musclesexercisemusculoskeletal systemLow back painAdaptation PhysiologicalMagnetic Resonance Imagingmedicine.anatomical_structureAdipose TissueselkäFemalemusclesmedicine.symptomcyclistsmusculoskeletal diseasesAdultmedicine.medical_specialtynikamavälilevyintervertebral diskbasck painParaspinal MusclesPhysical Therapy Sports Therapy and Rehabilitationpyöräilijät03 medical and health sciencesPhysical medicine and rehabilitationBody WaterHumanspyöräilybusiness.industryPotential riskIntervertebral disc030229 sport sciencesBicyclingbackbusinesshuman activitiesLow Back Painfysiologiset vaikutuksetMedicine and science in sports and exercise
researchProduct

Transversus abdominis and multifidus asymmetry in runners measured by MRI: a cross-sectional study

2019

ObjectiveThe transversus abdominis muscle (TrA) is active during running as a secondary respiratory muscle and acts, together with the multifidus, as trunk stabiliser. The purpose of this study was to determine size and symmetry of TrA and multifidus muscles at rest and with contraction in endurance runners without low back pain.DesignCross-sectional study.SettingA medical imaging centre in Melbourne, Australia.ParticipantsThirty middle-aged (43years±7) endurance-trained male (n=18) and female (n=12) runners without current or history of low back pain.Outcome measuresMRI at rest and with the core engaged. The TrA and multifidus muscles were measured for thickness and length (TrA) and antero…

Medicine (General)Contraction (grammar)Cross-sectional studyActivationlihaksetPhysical Therapy Sports Therapy and RehabilitationIsometric exerciseRunningjuoksu03 medical and health sciencesR5-9200302 clinical medicinevatsamedicineRespiratory muscleOrthopedics and Sports Medicine1506Transversus abdominisbusiness.industryRehabilitationmagneettikuvausMuscle activation030229 sport sciencesAnatomyLow back painTrunkasymmetriaMuscleOriginal ArticleCoremedicine.symptombusiness030217 neurology & neurosurgeryBMJ Open Sport &amp; Exercise Medicine
researchProduct

Estimating Lower Limb Skeletal Loading

2011

Osteoporosis, accidents and subsequent bone fractures cause suffering on an individual level, as well as an economical burden to the society (Ortiz-Luna et al., 2009; Stevens & Olson, 2000). It has been estimated that, in Finland alone, between 30,000 to 40,000 osteoporosis-related fractures occur annually and that 400,000 Finnish people have osteoporosis (Duodecim, 2008). There are a few potential ways of preventing bone fracture, i.e. strengthening bones and/or preventing falls (Ortiz-Luna et al., 2009; Stevens & Olson, 2000). In order to withstand prevalent loading without breaking; while remaining relatively light in weight to allow for locomotion, bones have the ability to adapt their …

Bone mineralOrthodonticsalaraajakuormausbusiness.industryluurankokuormitusOsteoporosisluuBone fracturemedicine.diseasemedicine.disease_causeSkeleton (computer programming)Lower limbWeight-bearingmedicineFracture (geology)lower limbbiomekaniikkaFalling (sensation)business
researchProduct

P 042 - Gait complexity quantified using inertial measurement units in children with cerebral palsy

2018

Abstract Children with cerebral palsy (CP) have gait impairments, and their gait is affected by concurrent tasks. We used inertial measurement units (IMU) to quantify CP-related gait complexity alterations, and identify effects of dual tasks on gait variability from 12 children with CP and 23 typically developed (TD) controls. The data were collected for normal and dual-tasks (motor; carrying a tray, cognitive; word naming) during walking. Step duration and adjusted multiscale entropy (MSE) index were computed. In overall, children with CP had shorter step duration and greater gait complexity than TD. Gait complexity was higher in vertical direction during the cognitive than normal and moto…

CP-oireyhtymämedicine.medical_specialtyKinematicsGait kinematicstasapainoBiophysicslapset (ikäryhmät)WalkingKinematicsCerebral palsyMultiscale entropy03 medical and health sciencesUnits of measurement0302 clinical medicineGait (human)Physical medicine and rehabilitationchildrenInertial measurement unitMedicineOrthopedics and Sports Medicine030212 general & internal medicineta315ta217cerebral palsy (CP)business.industryCP-vammaisetRehabilitationGait variabilitykehonhallintaCognitionmedicine.diseaseDual-taskCerebral palsybusinessStabilityhuman activities030217 neurology & neurosurgeryGait &amp; Posture
researchProduct

Effects of high intensity resistance aquatic training on body composition and walking speed in women with mild knee osteoarthritis : a 4-month RCT wi…

2017

Objective: To investigate the effects of 4-months intensive aquatic resistance training on body composition and walking speed in post-menopausal women with mild knee osteoarthritis (OA), immediately after intervention and after 12-months follow-up. Additionally, influence of leisure time physical activity (LTPA) will be investigated. Design: This randomised clinical trial assigned eighty-seven volunteer postmenopausal women into two study arms. The intervention group (n = 43) participated in 48 supervised intensive aquatic resistance training sessions over 4-months while the control group (n = 44) maintained normal physical activity. Eighty four participants continued into the 12-months' fo…

Aquatic exerciseOsteoarthritisWalking speedBody compositionlaw.invention0302 clinical medicineRandomized controlled triallawMedicineOrthopedics and Sports MedicineVolunteerOBESE ADULTSHigh intensityta3141HIP OSTEOARTHRITISMiddle AgedOsteoarthritis KneeRANDOMIZED CONTROLLED-TRIAL3. Good healthPostmenopauseFemaleWATER IMMERSIONLIMITATIONSmedicine.medical_specialtyPhysical ExertionBiomedical EngineeringEXERCISEwalking speed03 medical and health sciencesPhysical medicine and rehabilitationRheumatologyInternal medicineOsteoarthritisHumansOLDER-ADULTSMETAANALYSISAgedHydrotherapykehonkoostumus030203 arthritis & rheumatologybusiness.industryaquatic exerciseResistance Training030229 sport sciencesARTICULAR-CARTILAGEmedicine.disease3126 Surgery anesthesiology intensive care radiologyRheumatologyPreferred walking speedosteoarthritisOrthopedic surgeryLean body massPhysical therapyPatient ComplianceWEIGHTbusinesshuman activitiesFollow-Up Studies
researchProduct

Mechanical loading influences the lumbar intervertebral disc. A cross-sectional study in 308 athletes and 71 controls.

2020

There is evidence in animal populations that loading and exercise can positively impact the intervertebral disc (IVD). However, there is a paucity of information in humans. We examined the lumbar IVDs in 308 young athletes across six sporting groups (baseball, swimming, basketball, kendo, soccer, and running; mean age 19 years) and 71 nonathletic controls. IVD status was quantified via the ratio of IVD to vertebral body height (IVD hypertrophy) and ratio of signal intensity in the nucleus to that in the annulus signal (IVD nucleus hydration) on sagittal T2-weighted magnetic resonance imaging. P values were adjusted via the false discovery rate method to mitigate false positives. In examinin…

musculoskeletal diseasesMalemedicine.medical_specialtyBasketballAdolescent0206 medical engineering02 engineering and technologyMuscle hypertrophy03 medical and health sciencesYoung Adult0302 clinical medicineLumbarInternal medicinemedicineBack painHumansOrthopedics and Sports MedicineIntervertebral DiscExercise030203 arthritis & rheumatologyLumbar VertebraebiologyAthletesbusiness.industryIntervertebral discmusculoskeletal systembiology.organism_classification020601 biomedical engineeringLow back painAdaptation PhysiologicalMagnetic Resonance ImagingSagittal planemedicine.anatomical_structureCross-Sectional StudiesAthletesCardiologyFemaleStress Mechanicalmedicine.symptombusinesshuman activitiesJournal of orthopaedic research : official publication of the Orthopaedic Research SocietyREFERENCES
researchProduct

A Dynamic Simulation of a Human Gait Using the Hybrid Muscle Model and a QCT-Based Flexible Tibia

2009

The flexible multibody simulation [9] approach can be used in a wide variety of engineering applications. In a previous study of authors [1], flexible multibody simulation approach was used to estimate strains during walking at tibial midshaft. In the previous study, simple muscle models were used in conjunction with a flexible tibia model based on magnetic resonance images (MRI). This study is an extension of the previous developments [1], [2] demonstrating the potential of model improvement by introducing hybrid muscle models, along with the flexible tibia based model on computed tomography (CT). The computed tomography technique allows for the accounting of inhomogeneous density and elas…

Dynamic simulationMaterials sciencemedicine.diagnostic_testmedicineMagnetic resonance imagingTibiaElasticity (economics)musculoskeletal systemBiomedical engineeringVolume 4: 7th International Conference on Multibody Systems, Nonlinear Dynamics, and Control, Parts A, B and C
researchProduct

Reliability of upper-limb diaphyseal mineral and soft-tissue measurements using peripheral quantitative computed tomography (pQCT)

2018

Objectives: To quantify between-day reliability of upper-body diaphyseal measurements (radius, ulna, humerus) using peripheral Quantitative Computed Tomography (pQCT). - Methods: Fourteen males (age: 25.8±2.3 years,) underwent repeat pQCT scans (one to two days apart) at mid-shaft ulna (60%), mid-shaft radius (60%) and mid-shaft humerus (50%) cross-sections of the non-dominant limb. Intraclass correlation coefficients (ICC) and coefficients of variation (CV) were determined for musculoskeletal morphology variables. - Results: Reliability was excellent (ICC: 0.76–0.99; CV: 1.3– 7.3) at all sites for bone mass, stress-strain index, endocortical and pericortical radius, endocortical volumetric…

AdultMalereliabilityluuluuntiheysUlnaHumerusReliabilityCohort StudiesUpper ExtremityRadiusYoung AdulthumerustomografiaHumanstietokonetomografiaOriginal ArticleulnaTomography X-Ray ComputedBoneradiusreliabiliteetti
researchProduct

Association of developmental coordination disorder and low motor competence with impaired bone health: A systematic review.

2021

Aims Individuals with developmental coordination disorder (DCD) and low motor competence (LMC) may be at increased risk of low bone health due to their lifetime physical activity patterns. Impaired bone health increases an individual’s risk of osteoporosis and fracture; therefore, it is necessary to determine whether a bone health detriment is present in this group. Accordingly, this systematic review explores the association between DCD/LMC and bone health. Methods and Procedures Studies were included with assessment of bone health in a DCD/LMC population. Study bias was assessed using the JBI critical appraisal checklist. Due to heterogeneity, meta-analysis was not possible and narrative …

AdolescentMovementosteoporoosiluuWeight-Bearingmotorinen kehitysBone DensityDevelopmental and Educational PsychologyHumansmotoriset taidotChildluunmurtumatdyspraksiaExercisekaatuminenRehabilitationMotor Skills DisordersClinical PsychologyFracture1117 Public Health and Health Services 1303 Specialist Studies in Education 1701 PsychologykehityshäiriötOsteoporosisFallsterveysriskitfyysinen aktiivisuusResearch in developmental disabilities
researchProduct

The Effects of Restriction Pressures on the Acute Responses to Blood Flow Restriction Exercise

2019

Purpose: No current guidelines or recommendations exist informing the selection of restriction pressure during blood flow restriction exercise (BFRE). Moreover, the effects of specific relative restriction pressures on the acute muscle, metabolic and cardiopulmonary responses to BFRE are unclear. The purpose of this study was to characterize these acute responses at different levels of restriction pressure. Methods: Participants (n = 10) completed rhythmic isometric knee extension exercise across five experimental trials in a balanced randomized order. Three were BFRE trials {B-40 [restriction pressure set to 40% LOP (total limb occlusion pressure)]; B-60 (60% LOP); and B-80 (80% LOP)) with…

medicine.medical_specialtyKaatsuPhysiologyIsometric exerciseElectromyography030204 cardiovascular system & hematologyverenkiertoBlood flow restrictionVascular occlusionlcsh:Physiology03 medical and health sciences0302 clinical medicineEMGInternal medicinePhysiology (medical)Heart ratemedicinelimb occlusion pressureOriginal ResearchKaatsumedicine.diagnostic_testMuscle fatiguelcsh:QP1-981business.industrySkeletal muscle030229 sport sciencesrestriction pressuremedicine.anatomical_structureelektromyografialihasmassablood flow restrictionCardiologymuscle fatiguevoimaharjoittelumedicine.symptombusinesslihasvoimaFrontiers in Physiology
researchProduct

Assessing physical performance and physical activity in large population-based aging studies: home-based assessments or visits to the research center?

2019

Abstract Background The current study aims to compare correlations between a range of measures of physical performance and physical activity assessing the same underlying construct in different settings, that is, in a home versus a highly standardized setting of the research center or accelerometer recording. We also evaluated the selective attrition of participants related to these different settings and how selective attrition affects the associations between variables and indicators of health, functioning and overall activity. Methods Cross-sectional analyses comprising population-based samples of people aged 75, 80, and 85 years living independently in Jyväskylä, Finland. The AGNES stud…

GerontologyMaleAgingOffice VisitsWalkingliikunta0302 clinical medicinestudy designEpidemiologyAttritionotanta030212 general & internal medicineFinlandmedia_commonAged 80 and overeducation.field_of_studyexerciselcsh:Public aspects of medicinePhysical Functional PerformancekävelyHouse CallsFunctional impairmentResearch DesignFemaleResearch centerResearch Articlemedicine.medical_specialtypostural analysesmedia_common.quotation_subjectPopulationtoimintahäiriöt03 medical and health scienceswalkingmedicineHumansselection biasliikeanalyysieducationExerciseGeriatric AssessmentAgedSelection biasSelection biasbusiness.industryMuscle strengthPublic healthagingPublic Health Environmental and Occupational HealthStudy designlcsh:RA1-1270030229 sport sciencesmedicine.diseasePreferred walking speedCross-Sectional Studiesfunctional impairmentikääntyminenmuscle strengthBiostatisticsbusinessPostural analyseslihasvoimaBMC Public Health
researchProduct

Associations of physical activity intensities, impact intensities and osteogenic index with proximal femur bone traits among sedentary older adults

2021

Background Dynamic high-intensity physical activity is thought to be beneficial for older adults’ bone health. Traditional volume-based processing of accelerometer-measured physical activity data, quantified on a minute-per-minute basis, may average out sporadic high impact activity, whereas accelerometer data processing approaches based on identifying impacts can capture also these potentially beneficial short activity bursts. We investigated the associations between habitual physical activity and proximal femur bone traits among sedentary older adults utilizing three different numerical treatments of accelerometer-data to examine, if impact-based processing approaches are more suitable to…

Male0301 basic medicineHistologyPhysiologyEndocrinology Diabetes and MetabolismPopulationPhysical activityphysical activityluuntiheysPhysiology030209 endocrinology & metabolismBone remodelingistuminen03 medical and health sciencessedentaryAbsorptiometry Photon0302 clinical medicineBone DensityLinear regressionmineraalitHumansMedicineFemureducationkiihtyvyysExerciseolder adultsAgedFemoral neckBone mineralluustoeducation.field_of_studyFemur Neckbusiness.industrySection modulusIntensity (physics)accelerometerCross-Sectional Studies030104 developmental biologymedicine.anatomical_structureFemalebone mineral densitybusinessbone mineral contentfyysinen aktiivisuusikääntyneetBone
researchProduct

Reliability and concurrent validity of spatiotemporal stride characteristics measured with an ankle-worn sensor among older individuals

2019

Background. Wearable inertial sensors have been shown to provide valid mean gait characteristics assessments, however, assessment of variability is less convincingly established. Research question. What level of concurrent validity, and session-to-session reliability does an ankle-worn inertial measurement unit (IMU)-based gait assessment with a novel angular velocity-based gait event detection algorithm have among older adults? Methods. Twenty seven (women N = 17) participants volunteered (age 74.4 (SD 4.3) years, body mass 74.5 (12.0) kg, height 165.9 (9.9) cm). Right leg stance, swing, and stride duration and stride length, and stride velocity were concurrently assessed with motion captu…

Malemedicine.medical_specialtyConcurrent validityBiophysicsSTRIDEWalkingAccelerometergaitwearable03 medical and health sciences0302 clinical medicineGait (human)Physical medicine and rehabilitationInertial measurement unitAccelerometrymedicinemotion captureHumansOrthopedics and Sports MedicineGaitkiihtyvyysReliability (statistics)Agedbusiness.industryvariabilityRehabilitationReproducibility of Results030229 sport scienceskävelyaccelerometerliikkeentunnistusmedicine.anatomical_structureGait analysisFemaleAnkleAnklebusiness030217 neurology & neurosurgeryAlgorithmsAnkle JointikääntyneetGait & Posture
researchProduct

Corrigendum to “Increased cross-education of muscle strength and reduced corticospinal inhibition following eccentric strength training” [Neuroscienc…

2015

medicine.medical_specialtyPhysical medicine and rehabilitationGeneral NeuroscienceMuscle strengthmedicinePhysical therapyEccentric strengthPsychologyNeuroscienceCross educationNeuroscience
researchProduct

Count- versus MAD-based accelerometry-assessed movement behaviors and associations with child adiposity and fitness

2021

usc Estimations of time spent sedentary and in various physical activity intensities may vary according to data reduction methods applied. This study compared associations between children's accelerometer data and adiposity and fitness markers using open source (mean amplitude deviation, MAD) and proprietary (counts) data reduction methods. Complete-case accelerometer, adiposity (Body Mass Index z-score, waist circumference), and fitness (cardiorespiratory, musculoskeletal) data from 118 children (10.4 ± 0.6 years, 49% girls) were analyzed. Estimates of sedentary behavior, light-, moderate-, vigorous- (VPA), and moderate- to vigorous-intensity (MVPA) physical activity were calculated using …

MalePediatric ObesityWaistPhysical Therapy Sports Therapy and RehabilitationFitness TrackersAccelerometerobjectively measuredAccelerometryLinear regressionaccelerometryHumansMedicineOrthopedics and Sports MedicineHealth riskChildMuscle SkeletalExerciseAdiposityyouthbusiness.industrydevice-basedCardiorespiratory fitnessCircumferencemean amplitude deviationOpen sourceCardiorespiratory FitnessPhysical FitnessFemaleSedentary BehaviormovementbusinessBody mass indexDemography
researchProduct

Rifle and aiming point accelerations do not differ between the most and least accurate shots in biathlon shooting within an athlete

2023

Abstract Study aim: As studies from shooting disciplines other than biathlon have observed associations between weapon accelerations and shooting performance, this study investigated whether accelerations of the rifle stock and aiming point (the point on the target where the rifle is aimed at) are associated with shooting performance, and differences in rifle and aiming point accelerations between the most and least accurate shots. Further, associations between rifle and aiming point accelerations were studied. Materials and methods: Shooting performance (HitDist, hit point distance from the center of the target) along with rifle and aiming point accelerations were measured from nine biathl…

accelerometerampumahiihtoliikeoppikinematicsOrthopedics and Sports MedicinePhysical Therapy Sports Therapy and Rehabilitationpuettava teknologiatechniqueammuntarifle shootingwearableBiomedical Human Kinetics
researchProduct

Validity of Hip-worn Inertial Measurement Unit Compared to Jump Mat for Jump Height Measurement in Adolescents

2018

Jump tests assess lower body power production capacity, and can be used to evaluate athletic ability and development during growth. Wearable inertial measurement units (IMU) seem to offer a feasible alternative to laboratory-based equipment for jump height assessments. Concurrent validity of these devices for jump height assessments has only been established in adults. Therefore, the purpose of this study was to evaluate the concurrent validity of IMU-based jump height estimate compared to contact mat-based jump height estimate in adolescents. Ninety-five adolescents (10-13 years-of-age; girls N = 41, height = 154 (SD 9) cm, weight = 44 (11) kg; boys N = 54, height = 156 (10) cm, weight = 4…

MaleAdolescentConcurrent validity030209 endocrinology & metabolismPhysical Therapy Sports Therapy and RehabilitationAthletic PerformancekuntotestitAccelerometerwearableWearable Electronic Devices03 medical and health sciencesVertical jump0302 clinical medicineLower bodyInertial measurement unitStatisticsHumansOrthopedics and Sports MedicineChildta315MathematicsLimits of agreementReproducibility of Resultsmethodology030229 sport sciencesFlight timemittausmenetelmätaccelerometerExercise TestJumpFemalehyppääminenconcurrentScandinavian Journal of Medicine and Science in Sports
researchProduct

Fibula response to disuse : a longitudinal analysis in people with spinal cord injury

2021

Abstract Summary Fibular response to disuse has been described in cross-sectional but not longitudinal studies. This study assessed fibular bone changes in people with spinal cord injury. Fibular bone loss was less than in the tibia and was not correlated together. This might explain low fibular fracture incidents in these patients. Purpose Cross-sectional studies suggest that the fibula responds differently to loading and disuse compared to the tibia. Whilst tibial bone changes following spinal cord injury (SCI) have been established in longitudinal studies, fibular changes remain unexplored. Methods Fibular and tibial bone parameters were assessed in 13 individuals with SCI (aged 16–76 ye…

Adultmusculoskeletal diseasesselkäydinvammatAdolescentTibiaosteoporoosiRMiddle Agedmusculoskeletal systemmechanoadaptationspinal cord injuryfibulaYoung AdultBone DensityFibulaTA164HumansOrthopedics and Sports MedicineTomography X-Ray ComputedpQCTSpinal Cord InjuriesAgeddisuse osteoporosis
researchProduct

Laboratory-Based Gait Variability and Habitual Gait Entropy Do Not Differentiate Community-Dwelling Older Adults from Those with Subjective Memory Co…

2019

Background: Age-related cognitive decline may be delayed with appropriate interventions if those at high risk can be identified prior to clinical symptoms arising. Gait variability assessment has emerged as a promising candidate prognostic indicator, however, it remains unclear how sensitive gait variability is to early changes in cognitive abilities. Research question: Do community-dwelling adults over 65 years of age with subjective memory complaints differ from those with no subjective memory concerns in terms of laboratory-measured or free-living gait variability? Methods: This cross-sectional study recruited 24 (age = 73.5(SD 6.4) years) community-dwelling people with subjective memory…

Malemedicine.medical_specialtyEntropyBiophysicsPsychological interventionSubjective memorygaitwearable03 medical and health sciences0302 clinical medicinePhysical medicine and rehabilitationMemoryAccelerometrymedicineDementiaHumansOrthopedics and Sports MedicineCognitive DysfunctionCognitive declineGaitcognitive impairmentAgedAged 80 and overbusiness.industryscreeningactivityRehabilitationCognition030229 sport sciencesStride lengthmedicine.diseaseSample entropyCross-Sectional StudiesDementiaFemaleAnalysis of varianceIndependent LivingbusinessGait Analysishuman activities030217 neurology & neurosurgeryGaitposture
researchProduct

Effect of innervation zones in estimating biceps brachii force-EMG relationship during isometric contraction

2012

Measuring muscle forces in vivo is invasive and consequently indirect methods e.g., electromyography (EMG) are used in estimating muscular force production. The aim of the present paper was to examine what kind of effect the disruption of the physiological signal caused by the innervation zone has in predicting the force/torque output from surface EMG. Twelve men (age 26 (SD ±3)years; height 179 (±6)cm; body mass 73 (±6)kg) volunteered as subjects. They were asked to perform maximal voluntary isometric contraction (MVC) in elbow flexion, and submaximal contractions at 10%, 20%, 30%, 40%, 50% and 75% of the recorded MVC. EMG was measured from biceps brachii muscle with an electrode grid of 5…

AdultMaleMean squared errorintervation zonePhysical Exertionta221BiophysicsNeuroscience (miscellaneous)Isometric exerciseElectromyographyBicepsElectrode GridSensitivity and SpecificityRoot mean squareIsometric ContractionElbow JointmedicineMuscular forceHumansMuscle StrengthMuscle Skeletalta315ta218MathematicsOrthodonticsvalidationta214medicine.diagnostic_testta114ElectromyographyReproducibility of ResultsmodelingAnatomybody regionsNeurology (clinical)Stress Mechanicalhigh-density EMGneuromuscularLeave one out methodAlgorithmsJOURNAL OF ELECTROMYOGRAPHY AND KINESIOLOGY
researchProduct

Use of walking modifications, perceived walking difficulty and changes in outdoor mobility among community-dwelling older people during COVID-19 rest…

2021

Abstract Background Outdoor mobility enables participation in essential out-of-home activities in old age. Aim To compare changes in different aspects of outdoor mobility during COVID-19 restrictions versus two years before according to self-reported walking. Methods Community-dwelling participants of AGNES study (2017–2018, initial age 75–85) responded to AGNES-COVID-19 postal survey in spring 2020 (N = 809). Life-space mobility, autonomy in participation outdoors, and self-reported physical activity were assessed at both time points and differences according to self-reported walking modifications and difficulty vs. intact walking at baseline were analyzed. Results Life-space mobility and …

GerontologyAgingaktiivisuusCoronavirus disease 2019 (COVID-19)social isolationPsychological interventionvanhuksetWalkingliikuntaomatoimisuuscompensation03 medical and health sciences0302 clinical medicinevanhuussosiaalinen eristäytyminenmedicineHumansparticipation030212 general & internal medicineSocial isolationFunctional declineMobility LimitationAgedosallistuminenMobilityAged 80 and overSocial isolationPotential riskSARS-CoV-2agingParticipationCOVID-19mobilitykävelyPostal surveyDifficulty walkingikääntyminenOriginal ArticlerajoituksetIndependent LivingGeriatrics and Gerontologymedicine.symptomPsychologyOlder peopleCompensationhuman activities030217 neurology & neurosurgeryfyysinen aktiivisuusikääntyneet
researchProduct

Reduced Peak Bone Mass in Young Adults with Low Motor Competence

2023

Although suboptimal bone health has been reported in children and adolescents with low motor competence (LMC), it is not known whether such deficits are present at the time of peak bone mass. We examined the impact of LMC on bone mineral density (BMD) in 1043 participants (484 females) from the Raine Cohort Study. Participants had motor competence assessed using the McCarron Assessment of Neuromuscular Development at 10, 14, and 17 years, and a whole body dual-energy X-ray absorptiometry scan at 20 years. Bone loading from physical activity was estimated from the International Physical Activity Questionnaire at the age of 17. The association between LMC and BMD was determined using general …

DXAnuoret aikuisetluustoexerciseEndocrinology Diabetes and Metabolismscreeningsukupuolierotluuntiheysliikuntanuoretother disorders related to bonefracture preventionOrthopedics and Sports Medicinemotoriset taidotfyysinen aktiivisuusmotoriikka
researchProduct

Characterisation of peripheral bone mineral density in youth at risk of secondary osteoporosis : a preliminary insight

2020

Objectives: To describe peripheral long bone material and structural differences in youth at risk of secondary osteoporosis across disease-specific profiles. Methods: Upper- and lower limbs of children and adolescents were scanned at 4% distal and 66% mid-shaft sites using peripheral Quantitative Computed Tomography sub-categorised as (1) increased risk of secondary osteoporosis (neuromuscular disorders; chronic diseases; endocrine diseases; inborn errors of metabolism; iatrogenic conditions), (2) low motor competence and (3) non-affected controls. Results: Children with disease-specific profiles showed a range of bone deficits compared to the control group with these predominantly indicate…

morfologiariskiryhmätosteoporoosimorphologyluufragilityluuntiheyslapset (ikäryhmät)disordermovementluukudoksetappendicular
researchProduct

Associations between Perceived Outdoor Environment and Walking Modifications in Community-Dwelling Older People: A Two-Year Follow-Up Study

2020

Objectives: To examine associations of perceived outdoor environment with the prevalence and development of adaptive (e.g., slower pace) and maladaptive (e.g., avoiding walking) modifications in walking 2 km among older people. Methods: Community-dwelling 75–90 -year-old persons ( N = 848) reported environmental outdoor mobility facilitators and barriers at baseline. Modifications in walking 2 km (adaptive, maladaptive, or no) were assessed at baseline and one and two years later. Results: Outdoor mobility facilitators were more often reported by those not using modifications or using adaptive versus maladaptive walking modifications. Differences in health and physical capacity explained m…

GerontologyMaleasuinympäristöWalkingEnvironmentcompensation03 medical and health sciences0302 clinical medicineliikuntakykyHumans030212 general & internal medicinePaceAgedCommunity and Home CareAged 80 and overCompensation (psychology)agingFollow up studiesArticlesmobilityikääntyminenulkoliikuntaFemalePerceptionIndependent LivingGeriatrics and GerontologyOlder peoplePsychologyGerontologyenvironmenthuman activities030217 neurology & neurosurgeryfyysinen aktiivisuusikääntyneetFollow-Up StudiesJournal of Aging and Health
researchProduct

Effect of childhood developmental coordination disorder on adulthood physical activity; Arvo Ylppö longitudinal study

2022

Publisher Copyright: © 2022 The Authors. Scandinavian Journal of Medicine & Science In Sports published by John Wiley & Sons Ltd. Individuals at risk of Developmental Coordination Disorder (DCD) have low levels of physical activity in childhood due to impaired motor competence; however, physical activity levels in adulthood have not been established. This study sought to determine the impact of DCD risk on physical activity levels in adults using accelerometry measurement. Participants (n = 656) from the Arvo Ylppö Longitudinal Study cohort had their motor competence assessed at the age of five years, and their physical activity quantified via device assessment at the age of 25 years. Betwe…

Adultkoordinaatio (motoriikka)FITNESSPARTICIPATIONsensomotorinen kehitysdevelopmental disabilityCHILDRENPhysical Therapy Sports Therapy and RehabilitationpitkittäistutkimusliikuntaBody Mass IndexDEFICITSmotorinen kehitysADOLESCENTSAccelerometryHumansOrthopedics and Sports MedicineLongitudinal Studies315 Sport and fitness sciencesmotoriset taidotkehitysvammaisetExercisemotoriikkaOVERWEIGHTmittausEDUCATIONlapsuus1106 Human Movement and Sports Sciences 1116 Medical PhysiologyMotor Skills Disordersmotor competencekehityshäiriötOBESITYChild Preschoolfyysinen kehitysHEALTHTRAJECTORIESkehitysfyysinen aktiivisuusSport SciencesScandinavian Journal of Medicine &amp; Science in Sports
researchProduct

Exercise loading and cortical bone distribution at the tibial shaft

2011

Cortical bone is not a uniform tissue, and its apparent density [cortical volumetric density (vBMD)] varies around the bone cross-section as well as along the axial length of the bone. It is not yet known, whether the varying vBMD distribution is attributable to modulation in the predominant loads affecting bone. The aim of the present study was to compare the cortical bone mass distribution through the bone cortex (radial distribution) and around the center of mass (polar distribution) among 221 premenopausal women aged 17-40 years representing athletes involved in high impact, odd impact, high magnitude, repetitive low impact, repetitive non-impact sports and leisure time physical activit…

AdultApparent densityHistologyBone densityAdolescentPhysiologyEndocrinology Diabetes and MetabolismSignificant groupPhysical activityConcentricBiologyYoung AdultBone CortexBone DensitymedicineDistribution (pharmacology)Humansta315ExerciseAnalysis of VarianceTibiata3141Anatomymedicine.anatomical_structureCortical boneFemaleBone
researchProduct

Maximal voluntary isokinetic knee flexion torque is associated with femoral shaft bone strength indices in knee replacement patients.

2012

It is currently unknown whether knee replacement-associated bone loss is modified by rehabilitation programs. Thus, a sample of 45 (18 men and 25 women) persons with unilateral knee replacement were recruited; age 66 years (sd 6), height 169 cm (sd 8), body mass 83 kg (sd 15), time since operation 10 months (sd 4) to explore the associations between maximal torque/power in knee extension/flexion and femoral mid-shaft bone traits (Cortical cross-sectional area (CoA, mm(2)), cortical volumetric bone mineral density (CoD, mg/mm(3)) and bone bending strength index (SSI, mm(3))). Bone traits were calculated from a single computed tomography slice from the femoral mid-shaft. Pain in the operated …

Malemedicine.medical_specialtyWOMACTime FactorsKnee JointFemoral shaftmedicine.medical_treatmentKnee flexionKnee replacementModels BiologicalBone strengthBone DensitySurveys and QuestionnairesMedicineHumansOrthopedics and Sports MedicineFemurMuscle StrengthRange of Motion ArticularArthroplasty Replacement KneeMuscle SkeletalAgedPain MeasurementBone mineralOrthodonticsPain PostoperativeRehabilitationbusiness.industryStepwise regressionSurgeryTorqueFemaleStress MechanicalbusinessTomography X-Ray ComputedMuscle ContractionThe Knee
researchProduct

Efficacy of progressive aquatic resistance training for tibiofemoral cartilage in postmenopausal women with mild knee osteoarthritis : a randomised c…

2016

Objective: To study the efficacy of aquatic resistance training on biochemical composition of tibiofemoral cartilage in postmenopausal women with mild knee osteoarthritis (OA). Design: Eighty seven volunteer postmenopausal women, aged 60-68 years, with mild knee OA (Kellgren-Lawrence grades I/II and knee pain) were recruited and randomly assigned to an intervention (n = 43) and control (n = 44) group. The intervention group participated in 48 supervised aquatic resistance training sessions over 16 weeks while the control group maintained usual level of physical activity. The biochemical composition of the medial and lateral tibiofemoral cartilage was estimated using single-slice transverse …

Cartilage ArticularAquatic exerciseKnee JointrustoIsometric exerciseOsteoarthritislaw.invention0302 clinical medicineRandomized controlled triallawmagnetic resonance imagingMedicineOrthopedics and Sports MedicineRandomised controlled trialJOINTmagneettikuvausta3141Osteoarthritis KneePostmenopausemedicine.anatomical_structureFemalemedicine.symptomBONEmedicine.medical_specialtyGADOLINIUM-ENHANCED MRIBiomedical Engineering03 medical and health sciencesRheumatologyOsteoarthritisTHICKNESSWater environmentHumansMagnetic resonance imaging (MRI)030203 arthritis & rheumatologyRUNNING EXERCISEbusiness.industryCartilageaquatic exerciseResistance TrainingCardiorespiratory fitness030229 sport sciencesARTICULAR-CARTILAGEmedicine.disease3126 Surgery anesthesiology intensive care radiologyConfidence intervalGLYCOSAMINOGLYCAN DISTRIBUTIONQUANTITATIVE MRIosteoarthritisKnee painCartilagePHYSICAL-ACTIVITYPhysical therapyPATELLAR CARTILAGEbusinessrandomised controlled trial
researchProduct

Menopausal symptoms and cardiometabolic risk factors in middle-aged women : A cross-sectional and longitudinal study with 4-year follow-up

2023

Objective To study associations of menopausal symptoms with cardiometabolic risk factors. Study design A cross-sectional and longitudinal study of a representative population sample of 1393 women aged 47–55 years with a sub-sample of 298 followed for four years. The numbers of vasomotor, psychological, somatic or pain, and urogenital menopausal symptoms were ascertained at baseline through self-report. Their associations with cardiometabolic risk factors were studied using linear regression and linear mixed-effect models. Models were adjusted for age, menopausal status, body mass index, the use of hormonal preparations, education, smoking, and alcohol consumption. Main outcome measures Card…

obesitynaisetvaihdevuodetnight sweatspoikittaistutkimusObstetrics and GynecologymenopauseriskitekijätpitkittäistutkimusGeneral Biochemistry Genetics and Molecular Biologyhot flashesikääntymineninactivitycardiovascular diseasesydän- ja verisuonitauditlihavuushikoiluoireetmetabolinen oireyhtymäkehonkoostumus
researchProduct

FREE-LIVING AND LABORATORY-BASED GAIT ASSESSMENTS PROVIDE CONGRUENT RESULTS AMONG 75-YEAR-OLD MEN AND WOMEN

2018

It is often wondered how representative laboratory-based assessments are of the free-living condition. Indeed, free-living gait is more predictive of self-reported falls history compared to laboratory-based gait. However, explicit explorations of the relationship between laboratory-based and free-living based gait parameters remain scarce. Therefore, this association was studied using a trunk-worn accelerometer during a laboratory-based 6-min walking test, and in free-living conditions (6 days) in a sample of 75-year-old men and women (N=77). Gait quantity (minutes of walking per day, distance covered for free-living and laboratory, respectively) and quality (assessed with multiscale entrop…

Abstractsmedicine.medical_specialtyHealth (social science)Gait (human)Physical medicine and rehabilitationmedicineLife-span and Life-course StudiesPsychologyhuman activitiesHealth Professions (miscellaneous)Innovation in Aging
researchProduct

Effects of an individually targeted multicomponent counseling and home-based rehabilitation program on physical activity and mobility in community-dw…

2020

Objectives: The aim of this study is to evaluate the effects of multicomponent rehabilitation on physical activity, sedentary behavior, and mobility in older people recently discharged from hospital. Design: Randomized controlled trial. Setting: Home and community. Participants: Community-dwelling people aged ⩾60 years recovering from a lower limb or back musculoskeletal injury, surgery, or disorder were recruited from local health center hospitals and randomly assigned into an intervention ( n = 59) or a control (standard care, n = 58) group. Intervention: The six-month intervention consisted of a motivational interview, goal attainment process, guidance for safe walking, a progressive hom…

Malemedicine.medical_specialtymedicine.medical_treatmentPhysical activityDirective CounselingPhysical Therapy Sports Therapy and RehabilitationDirective Counselinglaw.inventionistuminen03 medical and health sciences0302 clinical medicineRandomized controlled triallawmobility functionIntervention (counseling)sedentary behaviorliikuntakykyMedicineHumans030212 general & internal medicineMusculoskeletal DiseasesRange of Motion ArticularExerciseinterventionAgedAged 80 and overRehabilitationbusiness.industryRehabilitationagingSedentary behaviorHome Care ServicesPatient DischargeExercise TherapyaccelerometerikääntyminenLower ExtremityPhysical therapyFemaleIndependent LivingSedentary BehaviorbusinessOlder people030217 neurology & neurosurgeryIndependent livingClinical rehabilitation
researchProduct

Bone rigidity to neuromuscular performance ratio in young and elderly men.

2009

Given the adaptation of bone to prevalent loading, bone loss should follow, but lag behind, the decline in physical performance during aging. Furthermore, bone responsiveness to load-induced strains is believed to decrease with aging. However, the relationship between bone and lean body ( approximately muscle) mass appears to remain rather constant throughout adulthood. The purpose of this study was to examine the association between age and bone to neuromuscular performance ratio. Young (N=20, age 24 SD+/-2 years, body mass 77+/-11 kg, height 178+/-6 cm) and elderly (N=25, 72+/-4 years, 75+/-9 kg, 172+/-5 cm) men served as subjects. Bone structural traits were measured at the right distal …

Malemedicine.medical_specialtyHistologyPhysiologyEndocrinology Diabetes and MetabolismYoung AdultInternal medicinemedicineHumansNervous System Physiological PhenomenaQuantitative computed tomographyAgedmedicine.diagnostic_testTibiabusiness.industryVertical ground reaction forceBody WeightBiomechanicsSection modulusAnatomyDistal tibiaBiomechanical PhenomenaEndocrinologyPerformance ratioPhysical performancebusinessBone structureBone
researchProduct

Altered prefrontal cortex responses in older adults with subjective memory complaints and dementia during dual-task gait: An fNIRS study.

2020

People with cognitive impairments show deficits during physical performances such as gait, in particular during cognitively challenging conditions (i.e. dual-task gait [DTG]). However, it is unclear if people at risk of dementia, such as those with subjective memory complaints (SMC), also display gait and central deficits associated with DTG. In this study, we investigated the effects of single- and dual-task gait (STG and DTG), on left prefrontal cortex (PFC) activation in elderly people with subjective memory complaints (SMC) and Dementia. A total of 58 older adults (aged 65-94 years; 26 Healthy; 23 SMC; 9 Dementia) were recruited. Gait spatiotemporal characteristics (i.e. stride velocity…

medicine.medical_specialtyHaemodynamic responseSTRIDEPrefrontal CortexSubjective memory03 medical and health sciences0302 clinical medicinePhysical medicine and rehabilitationNeuroimagingMemorymedicineDementiaHumansCognitive DysfunctionPrefrontal cortexGait030304 developmental biologyAged0303 health sciencesbusiness.industryGeneral NeuroscienceCognitionmusculoskeletal systemmedicine.diseaseGaitcardiovascular systemDementiabusiness030217 neurology & neurosurgeryThe European journal of neuroscienceREFERENCES
researchProduct

Increased cross-education of muscle strength and reduced corticospinal inhibition following eccentric strength training.

2015

Aim: Strength training of one limb results in a substantial increase in the strength of the untrained limb, however, it remains unknown what the corticospinal responses are following either eccentric or concentric strength training and how this relates to the cross-education of strength. The aim of this study was to determine if eccentric or concentric unilateral strength training differentially modulates corticospinal excitability, inhibition and the cross-transfer of strength. Methods: Changes in contralateral (left limb) concentric strength, eccentric strength, motor-evoked potentials, short-interval intracortical inhibition and silent period durations were analyzed in groups of young ad…

AdultMalemedicine.medical_specialtycrosstransferipsilateral motor cortexStrength trainingmedicine.medical_treatmentPyramidal TractsConcentricStimulus (physiology)Cross educationrecoveryPhysical medicine and rehabilitationcorticospinal inhibitionmedicineEccentricHumansMuscle Strengthta315Muscle Skeletalbusiness.industryElectromyographyGeneral NeuroscienceCorticospinal inhibitioncross-activationNeural InhibitionResistance TrainingOrgan SizeWristEvoked Potentials MotorTranscranial Magnetic StimulationTranscranial magnetic stimulationrecovery.Physical therapyEccentric trainingSilent periodFemalebusinessstrengthNeuroscience
researchProduct

A full body musculoskeletal model based on flexible multibody simulation approach utilised in bone strain analysis during human locomotion

2011

Load-induced strains applied to bone can stimulate its development and adaptation. In order to quantify the incident strains within the skeleton, in vivo implementation of strain gauges on the surfaces of bone is typically used. However, in vivo strain measurements require invasive methodology that is challenging and limited to certain regions of superficial bones only such as the anterior surface of the tibia. Based on our previous study [Al Nazer et al. (2008) J Biomech. 41:1036-1043], an alternative numerical approach to analyse in vivo strains based on the flexible multibody simulation approach was proposed. The purpose of this study was to extend the idea of using the flexible multibod…

EngineeringBiomedical EngineeringBioengineeringBone healingModels BiologicalMotion captureInverse dynamicsElastic ModulusTensile StrengthHumansComputer SimulationTibiaMuscle SkeletalStrain gaugeSimulationTibiabusiness.industryDynamics (mechanics)Multibody simulationGeneral MedicineStructural engineeringComputer Science ApplicationsHuman-Computer InteractionDynamic loadingStress MechanicalbusinessLocomotionMuscle ContractionComputer Methods in Biomechanics and Biomedical Engineering
researchProduct

Physical Activity Scaled to Preferred Walking Speed as a Predictor of Walking Difficulty in Older Adults: A 2-Year Follow-up

2021

Abstract Background The usual accelerometry-based measures of physical activity (PA) are dependent on physical performance. We investigated the associations between PA relative to walking performance and the prevalence and incidence of early and advanced walking difficulties compared to generally used measures of PA. Methods Perceived walking difficulty was evaluated in 994 community-dwelling participants at baseline (age 75, 80, or 85 years) and 2 years later over 2 km (early difficulty) and 500 m (advanced difficulty). We used a thigh-mounted accelerometer to assess moderate-to-vigorous PA, daily mean acceleration, and relative PA as movement beyond the intensity of preferred walking spee…

Agingmedicine.medical_specialtyPhysical activityWalkingmobility limitation03 medical and health sciencesexercise intensity0302 clinical medicinePhysical medicine and rehabilitationcut-pointKilometerAccelerometryHumansMedicine030212 general & internal medicineMobility LimitationExerciseaskelmittaritAgedbusiness.industryIncidence (epidemiology)ennusteetliikuntarajoitteetphysical performancekävelyWalking SpeedPreferred walking speedaccelerometerDifficulty walkingMobility LimitationdisablementExercise intensityObservational studyGeriatrics and Gerontologybusinesshuman activitiesfyysinen aktiivisuusikääntyneet030217 neurology & neurosurgeryFollow-Up StudiesThe Journals of Gerontology: Series A
researchProduct

Ikääntyvien kuntoutujien fyysinen aktiivisuus ja paikallaanolo laitoskuntoutusjakson aikana

2020

Fyysinen aktiivisuus on tärkeää sairauksista, vammoista tai heikentyneestä elämänhallinnasta kuntoutuessa ja ylläpidettäessä saavutettuja kuntoutumistuloksia. Tämän tutkimuksen tarkoituksena oli kuvata  ikääntyvien kuntoutujien fyysistä aktiivisuutta ja paikallaanoloa kuntoutuslaitoksessa. Tutkimus toteutettiin työkykyä ylläpitävän ja parantavan valmennuksen ja sydänkuntoutuksen kursseilla. Tutkimukseen osallistui 19 keskimäärin 57-vuotiasta miestä ja naista, joiden fyysistä aktiivisuutta ja paikallaanolo aikaa mitattiin kiihtyvyysanturilla viiden kuntoutuspäivän aikana. Tulokset osoittivat, että kuntoutujat olivat liikkumatta suurimman osan hereillä oloajasta. Toisaalta kuntoutujille kerty…

ikääntyminenfyysinen aktiivisuus paikallaanolo kuntoutus ikääntyminenliikkumattomuuskuntoutusArtikkelitfyysinen aktiivisuusGerontologia
researchProduct

Serratus anterior contraction during resisted arm extension (GravityFit) assessed by MRI

2019

Background: Scapular stabilization is a common focus of shoulder rehabilitation. Objective: Examine contraction of serratus anterior during a bilateral arm extension exercise with axial compression using an exercise device (GravityFit) by magnetic resonance imaging (MRI). Methods: MRI was performed under two conditions: rest and static arm extension with axial compression. Load was set at 20% of age, sex and weight estimated bench press one-repetition maximum. A T2-weighted sequence was used to collect 14 axial images of the upper thoracic spine and shoulder bilaterally. Mean muscle length and thickness were calculated for the whole muscle and in equidistant subregions of the muscle in its …

0301 basic medicineContraction (grammar)PhysiologymusclelihaksetBench presslcsh:PhysiologyfysioterapiarehabilitationUpper thoracic spine03 medical and health sciences0302 clinical medicineShoulder rehabilitationPhysiology (medical)Axial compressionupper extremityMedicinephysical therapyTransversus abdominisphysiotherapyOriginal Research030222 orthopedicslcsh:QP1-981medicine.diagnostic_testexercisebusiness.industrymagneettikuvausMagnetic resonance imagingAnatomyTrunk030104 developmental biologykuntoutusvoimaharjoittelubusiness
researchProduct

Musculoskeletal Responses to Exercise Plus Nutrition in Men with Prostate Cancer on Androgen Deprivation: A 12-Month RCT

2021

PURPOSE Androgen deprivation therapy (ADT) for prostate cancer has multiple adverse effects on musculoskeletal health. This 12-month randomized controlled trial aimed to assess the effects of multicomponent exercise training combined with whey protein, calcium and vitamin D supplementation on bone mineral density (BMD), structure and strength, body composition, muscle strength, and physical function in ADT-treated men. METHODS Seventy ADT-treated men were randomized to exercise plus supplementation (Ex + Suppl; n = 34) or usual care (control; n = 36). Ex + Suppl involved thrice weekly progressive resistance training plus weight-bearing impact exercise with daily multinutrient supplementatio…

Malemedicine.medical_specialtymusclelihaksetPhysical Therapy Sports Therapy and Rehabilitationandrogen deprivation therapybonelaw.inventionravintoAndrogen deprivation therapyProstate cancerRandomized controlled trialBone DensitylawInternal medicinemedicinecancerHumansOrthopedics and Sports MedicineMuscle StrengthVitamin DAdverse effectAgedFemoral neckBone mineralluustoexercisesyöpähoidoteturauhassyöpäkuntoliikuntabusiness.industryProstatic NeoplasmsAndrogen Antagonistsmedicine.diseaseConfidence intervalExercise TherapyCalcium DietarynutritionWhey Proteinsmedicine.anatomical_structureDietary SupplementsBody CompositionLean body massPatient CompliancesyöpätauditbusinessBiomarkersMedicine &amp; Science in Sports &amp; Exercise
researchProduct

Jump Height from Inertial Recordings : A Tutorial for a Sports Scientist

2019

Jump performance provides meaningful information both for sporting and clinical needs. Current state-of-the-art in jump performance assessment is laboratory-bound, however, out-of-the-laboratory methods are desirable. Therefore, the purposes of the present investigation were 1) to explore whether utilising a novel analytical approach minimises the bias between inertial recording unit (IMU)-based and jump mat-based jump height estimates, and 2) to provide a thorough tutorial for a sport scientist (see appendix) to facilitate standardisation of jump height estimation. Forty one women, men and boys aged 6 to 77 years-of-age completed three maximal counter movement jumps without arm swing, whic…

AdultMalegyroscopeInertial frame of referenceCorrelation coefficientAdolescentMovementPhysical Therapy Sports Therapy and Rehabilitation030204 cardiovascular system & hematologyAccelerometerwearablelaw.invention03 medical and health sciencesWearable Electronic DevicesYoung Adult0302 clinical medicineInertial measurement unitlawAccelerometryHumansOrthopedics and Sports MedicineliikeanalyysiChildsignal processingSimulationMathematicsAgedinertial measurement unitLimits of agreementGyroscope030229 sport sciencesMiddle AgedBiomechanical PhenomenamittausmenetelmätaccelerometerArm swingJumpExercise TestFemalehyppääminenperformance
researchProduct

Randomized Trial of General Strength and Conditioning versus Motor Control and Manual Therapy for Chronic Low Back Pain on Physical and Self-Report O…

2020

Exercise and spinal manipulative therapy are commonly used for the treatment of chronic low back pain (CLBP) in Australia. Reduction in pain intensity is a common outcome

medicine.medical_specialtymedicine.medical_treatmentlcsh:MedicinespinefysioterapiaArticlerehabilitationlaw.invention03 medical and health sciences0302 clinical medicineselkärankaRandomized controlled trialQuality of lifelawmedicinephysical therapylääkinnällinen kuntoutusphysiotherapyRehabilitationexercisebusiness.industrylcsh:RMotor control030229 sport sciencesGeneral MedicineTrunkhumanitiesChronic low back painPhysical therapyselkäkrooninen kipuConditioningManual therapybusinesshuman activities030217 neurology & neurosurgeryliikuntahoitofysikaalinen hoitoJournal of Clinical Medicine
researchProduct

The clinical relevance of adiposity when assessing muscle health in men treated with androgen deprivation for prostate cancer

2019

Background: Androgen deprivation therapy (ADT) for prostate cancer (PCa) may prospectively decrease absolute lean mass (LM) and increase absolute fat mass (FM). Given that estimates of LM by dual‐energy X‐ray absorptiometry may be overestimated in obese people, this study examined the influence of adiposity on muscle health in men treated with ADT for PCa. Methods: This cross‐sectional study examined the influence of adiposity on total and appendicular LM (ALM), muscle cross‐sectional (CSA), and muscle strength in 70 men treated with ADT [mean (standard deviation) age, 71 (6) years] for PCa compared with age‐matched PCa (n = 52) and healthy controls (n = 70). Total body LM, FM and ALM, and …

0301 basic medicineMaleSarcopenialcsh:Diseases of the musculoskeletal systemBody compositionprostatic neoplasmsBody Mass IndexAndrogen deprivation therapyProstate cancer0302 clinical medicineAbsorptiometry PhotonMedicineOrthopedics and Sports MedicineQuantitative computed tomographyAdipositymedicine.diagnostic_testeturauhassyöpäOrgan Sizelcsh:Human anatomyMiddle Agedadipose tissue030220 oncology & carcinogenesissyöpätauditOriginal ArticleProstatic neoplasmsmedicine.medical_specialtymedicine.drug_classUrologyrasvakudoksetAdipose tissuelcsh:QM1-695sarcopenia03 medical and health sciencesAtrophyPhysiology (medical)HumansMuscle SkeletalatrofiakehonkoostumusAgedbusiness.industryAndrogen AntagonistsOriginal Articlesmedicine.diseaseAndrogen030104 developmental biologyCross-Sectional StudiesSarcopeniaLean body massAtrophylcsh:RC925-935businessBody mass indexlihassurkastumasairaudetBiomarkersJournal of Cachexia, Sarcopenia and Muscle
researchProduct

Priming the Motor Cortex With Anodal Transcranial Direct Current Stimulation Affects the Acute Inhibitory Corticospinal Responses to Strength Trainin…

2019

Frazer, AK, Howatson, G, Ahtiainen, JP, Avela, J, Rantalainen, T, and Kidgell, DJ. Priming the motor cortex with anodal transcranial direct current stimulation affects the acute inhibitory corticospinal responses to strength training. J Strength Cond Res 33(2): 307-317, 2019-Synaptic plasticity in the motor cortex (M1) is associated with strength training (ST) and can be modified by transcranial direct current stimulation (tDCS). The M1 responses to ST increase when anodal tDCS is applied during training due to gating. An additional approach to improve the M1 responses to ST, which has not been explored, is to use anodal tDCS to prime the M1 before a bout of ST. We examined the priming effe…

Malecorticospinal silent periodmedicine.medical_treatmentstrength exercisePyramidal TractsIsometric exercise030204 cardiovascular system & hematologyTranscranial Direct Current Stimulation0302 clinical medicineElbowOrthopedics and Sports Medicineta315Cross-Over StudiesNeuronal PlasticityTranscranial direct-current stimulationMotor CortexGeneral Medicinemedicine.anatomical_structurestimulointiFemalecorticospinal excitabilityvoimaharjoitteluPriming (psychology)Motor cortexAdultmedicine.medical_specialtyStrength trainingkeskushermostoneuroplasticityeducationB100Physical Therapy Sports Therapy and RehabilitationInhibitory postsynaptic potentialta311203 medical and health sciencesYoung AdultPhysical medicine and rehabilitationDouble-Blind MethodIsometric ContractionNeuroplasticitymedicineHumansneuroplastisuusbusiness.industryResistance Training030229 sport sciencesEvoked Potentials MotorTranscranial magnetic stimulationaivokuoriNeuroplasticitytranscranial direct current stimulationbusinessJournal of strength and conditioning research
researchProduct

The ipsilateral corticospinal responses to cross-education are dependent upon the motor-training intervention

2018

This study aimed to identify the ipsilateral corticospinal responses of the contralateral limb following different types of unilateral motor-training. Three groups performing unilateral slow-paced strength training (SPST), non-paced strength training (NPST) or visuomotor skill training (VT) were compared to a control group. It was hypothesised that 4 weeks of unilateral SPST and VT, but not NPST, would increase ipsilateral corticospinal excitability (CSE) and reduce short-interval cortical inhibition (SICI), resulting in greater performance gains of the untrained limb. Tracking error of the untrained limb reduced by 29 and 41% following 2 and 4 weeks of VT. Strength of the untrained limb in…

AdultMalemedicine.medical_specialtyNeurologyStrength trainingTransfer Psychologymedicine.medical_treatmentPyramidal Tractsneurofysiologiacross-educationcorticospinalElectromyographyPhysical strengthFunctional LateralityCross educationYoung Adult03 medical and health sciencesSkills training0302 clinical medicinePhysical medicine and rehabilitationHumansMedicineMuscle StrengthMuscle Skeletalstrength-trainingmotoriset taidotPyramidal tractsmedicine.diagnostic_testElectromyographybusiness.industryGeneral NeuroscienceResistance Training030229 sport sciencesEvoked Potentials MotorTranscranial Magnetic StimulationTranscranial magnetic stimulationhermo-lihastoimintamedicine.anatomical_structureFemalevoimaharjoittelubusinessskill-trainingPsychomotor Performancecortical inhibition030217 neurology & neurosurgeryExperimental Brain Research
researchProduct

Muscle Activity and Inactivity Periods during Normal Daily Life

2013

Recent findings suggest that not only the lack of physical activity, but also prolonged times of sedentary behaviour where major locomotor muscles are inactive, significantly increase the risk of chronic diseases. The purpose of this study was to provide details of quadriceps and hamstring muscle inactivity and activity during normal daily life of ordinary people. Eighty-four volunteers (44 females, 40 males, 44.1±17.3 years, 172.3±6.1 cm, 70.1±10.2 kg) were measured during normal daily life using shorts measuring muscle electromyographic (EMG) activity (recording time 11.3±2.0 hours). EMG was normalized to isometric MVC (EMGMVC) during knee flexion and extension, and inactivity threshold o…

MaleActivities of daily livingAnatomy and PhysiologyTime FactorsOsteopenia and OsteoporosisIsometric exerciseElectromyographyCardiovascular SystemQuadriceps Muscletextile electrodes0302 clinical medicineActivities of Daily LivingBiomechanics030212 general & internal medicineMuscle activityta315Musculoskeletal Systeminactivelihasten aktiivisuusMultidisciplinarymedicine.diagnostic_testStair climbingQRMiddle AgedOccupational and Industrial Healthmusculoskeletal systemelektromyografiaMuscleMedicineFemalePublic Healthfyysinen aktiivisuusResearch ArticleinaktiivisuusAdultmedicine.medical_specialtySciencePhysical activitySittingNeurological System03 medical and health sciencesYoung AdultPhysical medicine and rehabilitationsedentarymedicineHumansSports and Exercise MedicineMuscle SkeletalAgedMotor Systemsbusiness.industryElectromyographyphysically active030229 sport sciencesbody regionsWomen's HealthExertionPreventive Medicinebusinesshuman activitiesHamstring
researchProduct

Daily Physical Activity and Sedentary Time Assessed by Acceleration Based on Mean Amplitude Deviation among Older People

2020

Accelerometer-derived estimates of physical activity (PA) and sedentary time have been an important methodological focus. However, little is known about the daily activities among older people during their normal lives. Furthermore, some older individuals would like to be more active, yet experience an unmet PA need, which is defined as the desire to engage in more PA but without the opportunity to act on the desire. This study examined the intensity of daily PA and sedentary behavior measured with accelerometers among older people, and whether PA differs between weekdays and weekends and those with and without the experience of unmet PA need, measured with self-reports. A total of 174 comm…

MaleGerontologyTime FactorsActivities of daily livinghealth promotionHealth Toxicology and MutagenesiseducationPhysical activityPsychological interventionlcsh:MedicineArticleterveyden edistäminen03 medical and health sciences0302 clinical medicineAccelerometryHumansMedicine030212 general & internal medicineExerciseAgedAged 80 and overSedentary timeLight Activitybusiness.industrylcsh:RPublic Health Environmental and Occupational Health030229 sport sciencesSedentary behaviormobilityinactivityFemaleSelf ReportSedentary BehaviorbusinessOlder peoplefyysinen aktiivisuusikääntyneet
researchProduct

Effects of an Individualized Active Aging Counseling Intervention on Mobility and Physical Activity: Secondary Analyses of a Randomized Controlled Tr…

2020

Objectives: The aim of this study was to report preplanned secondary analyses of the effects of a 12-month individualized active aging counseling intervention on six mobility and physical activity outcomes. Methods: A two-arm, single-blinded randomized controlled trial was conducted among 75- and 80-year-old community-dwelling people. The intervention group (IG, n = 101) received counseling aimed at increasing self-selected, primarily out-of-home activity. The control group (CG, n = 103) received general health information. Data were analyzed with generalized estimating equations. Results: Physical performance improved in the IG more than that in the CG (group by time p = .022), self-repor…

CounselingMaleAgingitsemäärääminenmedicine.medical_specialtymielekkyysfyysinen toimintakykyPhysical activityWalkingPhysical functionmeaningful activitylaw.invention03 medical and health sciencesphysical function0302 clinical medicineRandomized controlled triallawlife-spaceHumansMedicine030212 general & internal medicineMobility LimitationautonomyCounseling InterventionExerciseAgedAged 80 and overCommunity and Home Carebusiness.industryliikuntaneuvontaArticles030229 sport sciencessatunnaistetut vertailukokeet3. Good healthLife spacePersonal Autonomyrandomized controlled trialPhysical therapyFemaleIndependent LivingGeriatrics and Gerontologybusinessautonomy randomized controlled trialGerontologyRCTfyysinen aktiivisuusikääntyneetJournal of Aging and Health
researchProduct

Counselling for physical activity, life-space mobility and falls prevention in old age (COSMOS): protocol of a randomised controlled trial.

2019

IntroductionThe most promising way to promote active life years in old age is to promote regular participation in physical activity (PA). Maintaining lower extremity muscle function with good balance has been associated with fewer falls and the need of help from others. This article describes the design and intervention of a randomised controlled trial (RCT) investigating the effectiveness of a health and PA counselling programme on life-space mobility and falls rates in community-dwelling older adults at the Health Kiosk and/or Service Centre.Methods and analysisCommunity-dwelling men and women (n=450) aged 65 years and over with early phase mobility limitation will be recruited to a 24-mo…

CounselingMalephysical activityFear of fallinglaw.inventionolder people0302 clinical medicineRandomized controlled triallawActivities of Daily LivingPreventive Health ServicesfallsProtocolMedicine030212 general & internal medicine1506Postural BalanceRandomized Controlled Trials as TopickaatuminenSisätaudit - Internal medicineCognitionGeneral Medicine3. Good healthcounsellingFemaleIndependent LivingPublic Healthmedicine.symptomikääntyneetfyysinen aktiivisuusmedicine.medical_specialtylife-space mobilityterveyden edistäminen03 medical and health sciencesterveysneuvontaQuality of life (healthcare)Intervention (counseling)liikuntakykyHumans1724Mobility LimitationExerciseBalance (ability)AgedProtocol (science)business.industryResistance TrainingMoodPhysical therapyQuality of LifeAccidental Fallsbusiness030217 neurology & neurosurgeryProgram EvaluationBMJ open
researchProduct

Association between developmental coordination disorder or low motor competence, and risk of impaired bone health across the lifespan: protocol for a…

2020

OBJECTIVE: This systematic review will assess the association between developmental coordination disorder and low motor competence, and impairments in bone health across the lifespan. INTRODUCTION: Individuals with developmental coordination disorder tend to have a pattern of physical activity associated with bone health impairments. Preliminary studies have found impairments in bone health measures, including fractures, throughout the lifespan with potential public health ramifications. As studies in this area are of small samples across wide age ranges no comprehensive picture of bone health in this group has been formed, hindering action. A systematic review is needed to determine the po…

Gerontologymedicine.medical_specialtykoordinaatio (motoriikka)Bone densityluuPopulationLongevityluuntiheysBone healthMeta-Analysis as TopicBone DensitymedicineHumansmotoriset taidoteducationluunmurtumatCompetence (human resources)systemaattiset kirjallisuuskatsauksetGeneral Nursingeducation.field_of_studybusiness.industryPublic healthmeta-analyysiOdds ratioMotor Skills DisordersData extractionResearch DesignMeta-analysisbusinessSystematic Reviews as TopicJBI evidence synthesis
researchProduct

Effects of a Home‐Based Physical Rehabilitation Program on Tibial Bone Structure, Density, and Strength After Hip Fracture: A Secondary Analysis of a…

2019

Abstract Weight‐bearing physical activity may decrease or prevent bone deterioration after hip fracture. This study investigated the effects of a home‐based physical rehabilitation program on tibial bone traits in older hip fracture patients. A population‐based clinical sample of men and women operated for hip fracture (mean age 80 years, 78% women) was randomly assigned into an intervention (n = 40) and a standard care control group (n = 41) on average 10 weeks postfracture. The intervention group participated in a 12‐month home‐based rehabilitation intervention, including evaluation and modification of environmental hazards, guidance for safe walking, nonpharmacological pain management, m…

Orthopedic surgeryluustoINJURY/FRACTURE HEALINGexerciseagingluuEXERCISEDiseases of the musculoskeletal systemOriginal ArticlesliikuntaAGINGikääntyminenmurtumatRC925-935BONE QCT/μCTkliiniset kokeetOriginal ArticleRD701-811injury/fracture healingCLINICAL TRIALSJBMR Plus
researchProduct

Accelerometer-based osteogenic indices, moderate-to-vigorous and vigorous physical activity, and bone traits in adolescents

2022

Objectives: We investigated the associations of accelerometry-derived osteogenic indices (OIs), moderate-to-vigorous (MVPA), and vigorous intensity physical activity (VPA) with peripheral quantitative computed tomography (pCQT) parameters in 99 adolescents aged 10–13 years. Methods: Bone parameters were assessed at the distal (4%) and shaft (66%) of the tibia using pQCT. Accelerometers were worn on the right hip for 7 consecutive days. OIs were calculated based on acceleration peak histograms either using all of the peaks (OI) or peaks with acceleration ≥5.2 g (HOI). MVPA and VPA were defined using previously published cut-points. Results: HOI was positively associated with total area (Part…

accelerometerluustovigorous physical activitychildrenMVPAmoderate-to-vigorous physical activityluuntiheyslapset (ikäryhmät)VPAvarhaisnuoretliikuntaexercise paediatric skeletalfyysinen aktiivisuus
researchProduct

Beneficial Intervertebral Disc and Muscle Adaptations in High-Volume Road Cyclists

2019

PURPOSE: Cycling is widely practiced as a mode of transportation, a leisurely pursuit and a competitive sport. Approximately half of cyclists experience low back pain. Yet, there has been limited study of spine tissue adaptations due to cycling. METHODS: To investigate potential risk factors for spinal pain, we compared 18 high-volume cyclists (>150 km per week for ³5 years) to 18 height-matched non-sporting referents. Participants had no history of spinal pathology. Magnetic resonance imaging was used to quantify intervertebral disc (IVD) morphology and hydration; and psoas, erector spinae, quadratus lumborum and multifidus muscle size and fat content. Endurance of trunk muscles (flexors a…

musculoskeletal diseasesnikamavälilevycyclingintervertebral disklihaksetpyöräilijätmusculoskeletal systembackselkämusclescyclistshuman activitiespyöräilyfysiologiset vaikutuksetphysiological effects
researchProduct

Is Complexity of Daily Activity Associated with Physical Function and Life Space Mobility among Older Adults?

2022

Purpose Information about mobility, and physical function may be encoded in the complexity of daily activity pattern. Therefore, daily activity pattern complexity metrics could provide novel insight regarding the relationship between daily activity behaviour and health. The purpose of the present study was to examine the association between the complexity of daily activity behaviour, and mobility and physical function among community-dwelling older adults aged 75, 80, and 85 years-of-age. Methods A total of 309 participants wore accelerometers concurrently on the thigh and the trunk for at least 3 consecutive days. Five activity states (lying, sitting, standing, walking, or activity other t…

Physical Therapyfyysinen toimintakykyaktigrafiaSocial SciencesSports Therapy and RehabilitationkompleksisuusWEARABLEHABITUALACTIGRAPHYliikuntakykyMedicine and Health SciencesOrthopedics and Sports Medicinepuettava teknologiaikääntyneetfyysinen aktiivisuusAMBULATORY
researchProduct

Triceps surae fascicle stretch is poorly correlated with short latency stretch reflex size

2015

Introduction: The short latency stretch reflex (SLR) is well described, but the stimulus that evokes the SLR remains elusive. One hypothesis states that reflex size is proportional to muscle fiber stretch, so this study examined the relationship between these 2 parameters in human triceps surae muscles. Methods: Achilles tendon taps and dorsiflexion stretches with different amplitudes and preactivation torques were applied to 6 participants while electromyography and muscle fascicle length changes were recorded in soleus and medial gastrocnemius (MG). Results: In response to tendon taps, neither fascicle length nor velocity changes were correlated with SLR size in either muscle, but acceler…

muscle fasciclereflex EMGultraäänidorsiflexion stretchtendon tapmusculoskeletal system
researchProduct

Gait Variability Using Waist- and Ankle-Worn Inertial Measurement Units in Healthy Older Adults

2020

Gait variability observed in step duration is predictive of impending adverse health outcomes among apparently healthy older adults and could potentially be evaluated using wearable sensors (inertial measurement units, IMU). The purpose of the present study was to establish the reliability and concurrent validity of gait variability and complexity evaluated with a waist and an ankle-worn IMU. Seventeen women (age 74.8 (SD 44) years) and 10 men (73.7 (4.1) years) attended two laboratory measurement sessions a week apart. Their stride duration variability was concurrently evaluated based on a continuous 3 min walk using a force plate and a waist- and an ankle-worn IMU. Their gait complexity (…

MaleReproducibility of Resultsdynamicslcsh:Chemical technologygaitArticlewearablekävelyWearable Electronic DevicesaccelerometerHumansnon-linearFemalelcsh:TP1-1185liikeanalyysibiomekaniikkaAnkleGait Analysishuman activitiesikääntyneetAged
researchProduct

Individualized counselling for active aging: protocol of a single-blinded, randomized controlled trial among older people (the AGNES intervention stu…

2019

Background: Active aging has been established as a policy goal for aging societies. We define active aging at the individual level as striving for elements of well-being through activities in relation to a person’s goals, functional capacities and opportunities. Increasing evidence suggests that any meaningful activity is beneficial for different aspects of well-being in older people. The aim of the present randomized controlled trial is to test the feasibility and effectiveness of a one-year community-based intervention on active aging. The AGNES intervention aims at increasing older peoples’ participation in self-selected valued activities. Methods: The proposed study is a two-arm single-…

Quality of lifeCounselingMalebehavior changeAgingIndividualized counsellingtheory-based interventionHealth Behavioryksilöllinen hoitophysical activityelämänlaatulcsh:GeriatricsStudy ProtocolBehavior changeTheory-based interventionHumansCognitive DysfunctionSingle-Blind MethodExerciseFinlandAutonomy supportAgedosallistuminenMobilityAged 80 and overPhysical activityDepressionagingautonomiaParticipationlcsh:RC952-954.6autonomy supportikääntyminenliikkuvuusFemaleindividualized counsellingyksilöllisyysfyysinen aktiivisuusBMC Geriatrics
researchProduct

Supplemental_figure_2 – Supplemental material for Effects of an individually targeted multicomponent counseling and home-based rehabilitation program…

2020

Supplemental material, Supplemental_figure_2 for Effects of an individually targeted multicomponent counseling and home-based rehabilitation program on physical activity and mobility in community-dwelling older people after discharge from hospital: a randomized controlled trial by Katri M Turunen, Laura Aaltonen-Määttä, Timo Törmäkangas, Timo Rantalainen, Erja Portegijs, Sirkka Keikkala, Marja-Liisa Kinnunen, Taija Finni, Sarianna Sipilä and Riku Nikander in Clinical Rehabilitation

FOS: Clinical medicine110604 Sports MedicineFOS: Health sciences110904 Neurology and Neuromuscular Diseases110314 Orthopaedics
researchProduct

Identifying and Assessing Inter-Muscular Fat at the Distal Diaphyseal Femur Measured by Peripheral Quantitative Computed Tomography (pQCT)

2021

INTRODUCTION Inter/intramuscular fat can be assessed with peripheral Quantitative Computed Tomography (pQCT) and is of interest as an indicator of ‘muscle quality’. Typical pQCT scan sites (forearm, lower leg) have a low amount of inter/intramuscular fat, however distal diaphyseal femur scan sites with conspicuous inter/intramuscular fat have been identified as potentially more prudent scan sites, even in healthy adolescents. However, current state of the art analysis methods require labour-intensive manual segmentation of the scan. The purpose of the present study was to evaluate the reliability of a novel open source automated enclosing convex polygon approach (source code https://github.…

musculoskeletal diseasesluustosubcutaneous fatmusclerasvakudoksetlihaksetmusculoskeletal systembonekuvantaminenpehmytkudoksettietokonetomografiaconvex envelopesoft tissueconvex hullkehonkoostumus
researchProduct

Does Use of Androgen Deprivation Therapy (ADT) in Men with Prostate Cancer Increase the Risk of Sarcopenia?

2019

Androgen deprivation therapy (ADT) for prostate cancer (PCa) can compromise muscle health. Hence, we aimed to quantify the prevalence of sarcopenia (i.e., compromised lean mass, muscle strength, and physical function) in ADT-treated (> 12 week) men (n = 70) compared to similarly aged non-ADT-treated PCa (n = 52) and healthy controls (n = 70). Lean and fat mass were quantified by dual-energy X-ray absorptiometry. Muscle strength and function were measured using handgrip dynamometry and gait speed, respectively. Sarcopenia was defined as low adjusted appendicular lean mass [ALM; height-adjusted (ALMI), body mass index-adjusted (ALMBMI) and height and fat mass-adjusted (ALMHFM)] with weak hand…

kasvaimetlihavuuslihakseteturauhanenhuman activitiesatrofiakehonkoostumus
researchProduct

Age-related muscle activation profiles and joint stiffness regulation in repetitive hopping

2011

It is well documented that increasing effort during exercise is characterized by an increase in electromyographic activity of the relevant muscles. How aging influences this relationship is a matter of great interest. In the present study, nine young and 24 elderly subjects did repetitive hopping with maximal effort as well as with 50%, 65%, 75% and 90% intensities. During hopping joint kinematics were measured together with electromyographic activity (EMG) from the soleus, gastrocnemius medialis, gastrocnemius lateralis and tibialis anterior muscles. The results showed that agonist activation increased in both age groups with increasing intensity. The highest jumping efficiency (EMG ratio …

AgingikääntyminenStiffness controlniveljäykkyysneuraalinen ohjausStretch-shortening cycleNeural control
researchProduct

Associations of physical activity in detailed intensity ranges with body composition and physical function : a cross-sectional study among sedentary …

2020

Background Physical activity is crucial to maintain older adults’ health and functioning, but the health benefits of particular activity intensities remain unclear. The aim of this cross-sectional study was to peruse the distribution of physical activity, and to investigate the associations of particular physical activity intensities with body composition and physical function among older adults. Methods The sample comprised of 293 community-dwelling sedentary or at most moderately active older adults (42% men, mean age 74 ± 4 years). Physical activity was measured with a hip-worn tri-axial accelerometer over seven consecutive days, and investigated in detailed intensity range and in catego…

suorituskykyaccelerometerrasvaprosenttifyysinen toimintakykyphysical performancewalking speedfat percenthuman activitiescommunity-dwellingikääntyneetfyysinen aktiivisuuskävelykehonkoostumus
researchProduct

Outdoor Mobility and Use of Adaptive or Maladaptive Walking Modifications among Older People

2020

Background. In old age, decline in functioning may cause changes in walking ability. Our aim was to study whether older people who report adaptive, maladaptive or no walking modifications differ in outdoor mobility. Methods. Community-dwelling people aged 75–90 years (N=848) were interviewed at baseline, of whom 761 participated in the 2-year follow-up. Walking modifications were assessed by asking the participants whether they had modified their way of walking 2 kilometers due to their health. Based on the responses, three categories were formed: no walking modifications (reference), adaptive (e.g., walking more slowly, using an aid) and maladaptive walking modifications (reduced frequency…

suorituskykyikääntyminenphysical functionfunctional performanceagingfyysinen toimintakykyphysical activityhuman activitiesfyysinen aktiivisuustoiminnallisuus
researchProduct

Supplemental_tables – Supplemental Material for Associations between Perceived Outdoor Environment and Walking Modifications in Community-Dwelling Ol…

2020

Supplemental Material, Supplemental_tables for Associations between Perceived Outdoor Environment and Walking Modifications in Community-Dwelling Older People: A Two-Year Follow-Up Study by Heidi Skantz, Taina Rantanen, Timo Rantalainen, Kirsi E. Keskinen, Lotta Palmberg, Erja Portegijs, Johanna Eronen and Merja Rantakokko in Journal of Aging and Health

FOS: Clinical medicine111799 Public Health and Health Services not elsewhere classifiedFOS: Health sciences110306 Endocrinology110308 Geriatrics and Gerontology
researchProduct

The effects of a physical and cognitive training intervention vs. physical training alone on older adults' physical activity : A randomized controlle…

2021

BackgroundExecutive functions underlie self-regulation and are thus important for physical activity and adaptation to new situations. The aim was to investigate, if yearlong physical and cognitive training (PTCT) had greater effects on physical activity among older adults than physical training (PT) alone, and if executive functions predicted physical activity at baseline, after six (6m) and twelve months (12m) of the interventions, one-year post-intervention follow-up and an extended follow-up during COVID-19 lockdown.MethodsData from a single-blinded, parallel-group randomized controlled trial (PASSWORD-study, ISRCTN52388040) were utilized. Participants were 70-85 years old community-dwel…

MaleViral DiseasesPhysiologyEpidemiologySocial SciencesWalkingExecutive FunctionMedical ConditionsElderlyMedicine and Health SciencesPROGRAMPsychologyPublic and Occupational HealthSingle-Blind MethodGerontologi medicinsk/hälsovetenskaplig inriktningApplied PsychologyVirus TestingAged 80 and overkuntoliikuntaQEXECUTIVE FUNCTIONSRPublic Health Global Health Social Medicine and EpidemiologyinterventiotutkimusSports ScienceMultidisciplinary SciencesInfectious DiseasesTreatment OutcomeMedicineScience & Technology - Other TopicsFemaleikääntyneetfyysinen aktiivisuusResearch Articletoiminnanohjaus (psykologia)harjoitteetGeneral Science & TechnologyScienceEXERCISEADHERENCEAGEDiagnostic MedicinePEOPLEAdultsHumansGerontology specialising in Medical and Health SciencesSports and Exercise MedicinePandemicsAgedBehaviorScience & TechnologyTrail Making TestBiological LocomotionSARS-CoV-2DISABILITYKlinisk medicinBiology and Life SciencesCOVID-19Covid 19Physical ActivityPERFORMANCETillämpad psykologiEFFICACYLIFEFolkhälsovetenskap global hälsa socialmedicin och epidemiologiLogistic ModelsAge GroupsPhysical FitnessPeople and PlacesPopulation GroupingsClinical MedicineFollow-Up Studies
researchProduct

Validity of Hip-worn Inertial Measurement Unit Compared to Jump Mat for Jump Height Measurement in Adolescents

2018

Jump tests assess lower body power production capacity, and can be used to evaluate athletic ability and development during growth. Wearable inertial measurement units (IMU) seem to offer a feasible alternative to laboratory‐based equipment for jump height assessments. Concurrent validity of these devices for jump height assessments has only been established in adults. Therefore, the purpose of this study was to evaluate the concurrent validity of IMU‐based jump height estimate compared to contact mat‐based jump height estimate in adolescents. Ninety‐five adolescents (10‐13 years‐of‐age; girls N = 41, height = 154 (SD 9) cm, weight = 44 (11) kg; boys N = 54, height = 156 (10) cm, weight = 4…

accelerometermetodologiahyppääminenconcurrentkuntotestitwearablemittausmenetelmät
researchProduct

Treatment with soluble activin type IIB-receptor improves bone mass and strength in a mouse model of Duchenne muscular dystrophy

2017

Background: Inhibition of activin/myostatin pathway has emerged as a novel approach to increase muscle mass and bone strength. Duchenne muscular dystrophy (DMD) is a neuromuscular disorder that leads to progressive muscle degeneration and also high incidence of fractures. The aim of our study was to test whether inhibition of activin receptor IIB ligands with or without exercise could improve bone strength in the mdx mouse model for DMD. Methods: Thirty-two mdx mice were divided to running and non-running groups and to receive either PBS control or soluble activin type IIB-receptor (ActRIIB-Fc) once weekly for 7 weeks. Results: Treatment of mdx mice with ActRIIB-Fc resulted in significantly…

bone-muscle interactionsOXIDATIVE CAPACITYMDX MICEbone μCTexerciseBLOCKINGBone mu CTEXERCISEPREVENTS3126 Surgery anesthesiology intensive care radiologyMYOSTATINBone-muscle interactionsanimal modelsAnimal modelsDEFICIENCYTGF-βsDENSITY3121 General medicine internal medicine and other clinical medicineMUSCLE PROTEIN-SYNTHESISOrthopedics and Sports MedicineTGF-beta sMETAANALYSIS
researchProduct

Role of motor cortex during drop jump: motor cortical excitability assessed with TMS and H-reflex stimulation

2005

TMSspinalexcitabilitymotor programcorticaldrop jump
researchProduct

Markerless 2D kinematic analysis of underwater running : A deep learning approach

2019

Kinematic analysis is often performed with a camera system combined with reflective markers placed over bony landmarks. This method is restrictive (and often expensive), and limits the ability to perform analyses outside of the lab. In the present study, we used a markerless deep learning-based method to perform 2D kinematic analysis of deep water running, a task that poses several challenges to image processing methods. A single GoPro camera recorded sagittal plane lower limb motion. A deep neural network was trained using data from 17 individuals, and then used to predict the locations of markers that approximated joint centres. We found that 300–400 labelled images were sufficient to tra…

liikeoppivesijuoksudeep learningliikeanalyysideep water runningtekoäly
researchProduct

Characterization of Intervertebral Disc Changes in Asymptomatic Individuals with Distinct Physical Activity Histories Using Three Different Quantitat…

2020

(1) Background: Assessments of intervertebral disc (IVD) changes, and IVD tissue adaptations due to physical activity, for example, remains challenging. Newer magnetic resonance imaging techniques can quantify detailed features of the IVD, where T2-mapping and T2-weighted (T2w) and Dixon imaging are potential candidates. Yet, their relative utility has not been examined. The performances of these techniques were investigated to characterize IVD differences in asymptomatic individuals with distinct physical activity histories. (2) Methods: In total, 101 participants (54 women) aged 25&ndash

musculoskeletal diseasesnikamavälilevysport medicinemagneettikuvauslcsh:Rlcsh:Medicinemusculoskeletal systemArticleselkärankaDixonmagnetic resonance imagingDixon imagingintervertebral discT2-mappingfyysinen aktiivisuusJournal of Clinical Medicine
researchProduct

Neuromuscular function and bone geometry and strength in aging

2010

luustoneuromuscular performanceikääntyminenneuromuskulaarinen suorituskykyosteoporoosiagingbone geometrypredictors of bone strengthbonelonkkaluunmurtumat
researchProduct

Appendicular fracture epidemiology of children and adolescents: a 10-year case review in Western Australia (2005 to 2015)

2018

Fracture incidence data of Australian children and adolescents have not been reported in the literature. A 10-year case review of fracture presentations in Western Australia is provided. Between 2005 and 2015, fracture incidence increased relative to population growth. This is concerning, and interventions are required to reverse this trend. Purpose Fracture incidence in 0–16-year-olds is high and varies between countries. Boys have a 1.5:1 ratio of fracture incidence compared to girls. There are no specific data for Australia. Western Australia is a state with unique geography and population distribution having only a single tertiary paediatric hospital (Princess Margaret Hospital, PMH, in…

paediatricnuoretluuväestöauditlapset (ikäryhmät)epidemiologiailmaantuvuusluunmurtumat
researchProduct

Exercise for the intervertebral disc : a 6-month randomised controlled trial in chronic low back pain

2020

Background context Muscle, bone and tendon respond anabolically to mechanical forces. Whether the intervertebral disc (IVD) can benefit from exercise is unclear. Purpose To examine whether exercise can beneficially affect IVD characteristics. Study design/setting This is a single-blinded 6-month randomised controlled trial (ACTRN12615001270505) in an exercise and physiotherapy clinic. Patient sample Forty patients with chronic non-specific low back pain (NSCLBP) are included in this study. Outcome measures The primary outcome was lumbar IVD T2 time (MRI). Secondary outcomes included IVD diffusion coefficient and IVD expansion with short-duration lying. Methods Twenty patients progressively …

musculoskeletal diseasesnikamavälilevymagneettikuvausphysical activityliikuntamusculoskeletal systemspinefysioterapiarehabilitationselkärankamagnetic resonance imagingkrooninen kipuphysical therapyintervertebral disckuntoutusphysiotherapyfyysinen aktiivisuusliikuntahoito
researchProduct

Metabolic health, menopause, and physical activity : a 4-year follow-up study

2022

Background In women, metabolic health deteriorates after menopause, and the role of physical activity (PA) in mitigating the change is not completely understood. This study investigates the changes in indicators of metabolic health around menopause and evaluates whether PA modulates these changes. Methods Longitudinal data of 298 women aged 48–55 years at baseline participating in the ERMA and EsmiRs studies was used. Mean follow-up time was 3.8 (SD 0.1) years. Studied indicators of metabolic health were total and android fat mass, waist circumference, waist-to-hip ratio (WHR), systolic (SBP) and diastolic (DBP) blood pressure, blood glucose, triglycerides, serum total cholesterol, and high…

vaihdevuodetrisk factorsseurantatutkimusriskitekijätmetabolinen oireyhtymämetabolic syndromefyysinen aktiivisuus
researchProduct

Sedentary Thresholds for Accelerometry-Based Mean Amplitude Deviation and Electromyography Amplitude in 7–11 Years Old Children

2019

We investigated the ability of energy expenditure, movement sensing, and muscle activity to discriminate sedentary and non-sedentary activities in children. Thirty-five 7–11-year-old children participated in the study. Simultaneous assessment of oxygen uptake (V̇O2), triaxial accelerometry, and thigh muscle electromyography (EMG) were performed during eight different sedentary and non-sedentary activities including lying down, sitting-, standing-, and walking-related activities, which were performed in a random order. Mean values of V̇O2, accelerometry, and EMG from the concurrent 2 min epochs during each activity were computed. Resting energy expenditure (REE) was measured during 30 min su…

electromyographyPhysiologysittinglapset (ikäryhmät)seisominenresting energy expenditureistuminenelektromyografiaaccelerometrystandingenergiankulutus (aineenvaihdunta)fyysinen aktiivisuuspostureOriginal ResearchFrontiers in Physiology
researchProduct

Associations of fitness, motor competence, and adiposity with the indicators of physical activity intensity during different physical activities in c…

2021

We investigated the associations of peak oxygen uptake (V̇O2peak), ventilatory threshold (VT), muscle strength, motor competence (MC), and adiposity with the indicators of PA intensity during different physical activities used to create absolute PA intensity cut-offs among 35 children 7–11-years-of-age. V̇O2peak was defined as the highest V̇O2 achieved in the maximal cardiopulmonary exercise test (CPET) on a cycle ergometer, self-paced running, or running on a treadmill at 8 km/h. VT was defined from the CPET data. Peak isometric knee extensor and flexor strength was assessed by a dynamometer, MC by the Körperkoordination test für Kinder tests, and body composition by the bioelectrical impe…

MalePhysiologyEpidemiologySciencelapset (ikäryhmät)WalkingArticleRunningOxygen ConsumptionAccelerometrymaksimaalinen hapenottoHumansObesityChildmotoriset taidotExerciseAdipositykehonkoostumusElectromyographyQRfyysinen kuntoPhysical FitnessChild PreschoolphysiologyBody CompositionExercise TestMedicineFemaleepidemiologyfyysinen aktiivisuuslihasvoimaScientific Reports
researchProduct

Additional file 1 of Development of a Parkinson���s disease specific falls questionnaire

2021

Additional file 1.

Data_FILES
researchProduct

Functional Basis of Asymmetrical Lower-Body Skeletal Morphology in Professional Australian Rules Footballers

2020

Hart, NH, Newton, RU, Weber, J, Spiteri, T, Rantalainen, T, Dobbin, M, Chivers, P, and Nimphius, S. Functional basis of asymmetrical lower-body skeletal morphology in elite Australian footballers. J Strength Cond Res 34(3): 791–799, 2020—Bone strength is a product of its material and structural properties and is highly responsive to mechanical load. Given the measureable and adaptable features of bone, and thus relevance to medical screening, injury prevention, and injury management in athletes, this study describes the lower-body skeletal morphology of professional Australian rules footballers. Using a cross-sectional and quantitative study design, 54 professional Australian rules football…

symmetrialuustoimbalancemorfologiamuscleasymmetrialuulihaksetadaptationjalat
researchProduct

Effects of a multicomponent resistance-based exercise program with protein, vitamin D and calcium supplementation on cognition in men with prostate c…

2022

Objectives The aim of this preplanned secondary analysis of a 12-month randomised controlled trial was to investigate the effects of a multicomponent exercise programme combined with daily whey protein, calcium and vitamin D supplementation on cognition in men with prostate cancer treated with androgen deprivation therapy (ADT). Design 12-month, two-arm, randomised controlled trial. Setting University clinical exercise centre. Participants 70 ADT-treated men were randomised to exercise-training plus supplementation (Ex+ Suppl, n=34) or usual care (control, n=36). Intervention Men allocated to Ex + Suppl undertook thrice weekly resistance training with weight-bearing exercise training plus d…

kognitioeturauhassyöpäandrogen deprivation therapyravintoainevalmisteetandrogeenithoito
researchProduct

Associations of age, body size, and maturation with physical activity intensity in different laboratory tasks in children

2021

We investigated the associations of age, sex, body size, body composition, and maturity with measures of physical activity (PA) intensity in children. PA intensity was assessed using VO2 as % of VO2reserve or VO2 at ventilatory threshold (VT), muscle activity measured by textile electromyography, mean amplitude deviation (MAD) measured by accelerometry, and metabolic equivalent of task (MET) during laboratory activities.Age, stature, and muscle mass were inversely associated with VO2 as % of VO2reserve and % of VT, during walking or running on a treadmill for 4, 6, and 8 km/h (Spearman r = -0.645 to -0.358). Age was inversely associated with MAD during walking on treadmill for 4 km/h (r = -…

childelectromyographybody compositionelektromyografiaaccelerometryphysical activitylapset (ikäryhmät)human activitiesfyysinen aktiivisuuskehonkoostumushapenotto
researchProduct

Short term bone biochemical response to a single bout of high-impact exercise

2006

Rantalainen, Timo. 2006. Short term bone biochemical response to a single bout of high-impact exercise. Department of Biology of Physical Activity, University of Jyväskylä. Master thesis in Exercise Physiology. 29 pages. INTRODUCTION: Bones adapt to imposed loading environment, but the adaptive process takes years to complete. The state of skeletal turnover can be evaluated with biochemical markers of bone formation and resorption. Thus it is possible to observe the response of bone to a single bout of exercise. Currently the results concerning acute short term bone response after a single bout of loading are equivocal. Therefore, the purpose of the study was to examine the response of bone…

markerexerciseshort termbiochemicalbone
researchProduct

Effects of a progressive aquatic resistance exercise program on the biomechanical composition and morphology of cartilage in women with mild knee ost…

2013

Background. Symptoms associated with osteoarthritis of the knee result in decreased function, loss of working capacity and extensive social and medical costs. There is a need to investigate and develop effective interventions to minimise the impact of and even prevent the progression of osteoarthritis. Aquatic exercise has been shown to be effective at reducing the impact of osteoarthritis. The purpose of this article is to describe the rationale, design and intervention of a study investigating the effect of an aquatic resistance exercise intervention on cartilage in postmenopausal women with mild knee osteoarthritis. Methods. A minimum of 80 volunteers who meet the inclusion criteria will…

dGEMRICAquatic exerciseOsteoarthritisluuQuantitative MRIT2 relaxation time
researchProduct

Altered prefrontal cortex responses in older adults with subjective memory complaints and dementia during dual‐task gait : an fNIRS study

2021

People with cognitive impairments show deficits during physical performances such as gait, in particular during cognitively‐challenging conditions (i.e. dual‐task gait [DTG]). However it is unclear if people at risk of dementia, such as those with subjective memory complaints (SMC), also display gait and central deficits associated with DTG. In this study, we investigated the effects of single‐ and dual‐task gait (STG and DTG), on left prefrontal cortex (PFC) activation in elderly people with subjective memory complaints (SMC) and Dementia. 58 older adults (aged 65‐94 yrs; 26 Healthy; 23 SMC; 9 Dementia) were recruited. Gait spatiotemporal characteristics (i.e. stride velocity and length) w…

kognitiiviset taidotneuroimagingliikeoppikeskushermostomuistihäiriötneurodegenerationcognitive demandsliikuntamusculoskeletal systemGait kinematicskävelyaivokuoritoimintakykybrain activationcardiovascular systemaivothuman activitiesdementiamuisti (kognitio)
researchProduct

Accelerometer-measured and self-reported physical activity in relation to extraversion and neuroticism: a cross-sectional analysis of two studies

2020

Background Personality reflects relatively stable and pervasive tendencies in feeling, thinking and behaving. While previous studies have found higher extraversion and lower neuroticism to be linked to higher self-reported physical activity levels, larger studies using accelerometer-measured physical activity are lacking. This study investigated the cross-sectional associations of extraversion and neuroticism with both accelerometer-measured and self-reported physical activity and the role of these personality traits in possible discrepancies between these two measures of physical activity among Finnish adults. Methods Two community-dwelling samples were used in this study: a) 47–55-yr-old …

MalePersonality Inventorylcsh:GeriatricsExtraversion Psychologicaltraitsmental disordersAccelerometryHumansExerciseAgedNeuroticismitsearviointikiihtyvyysanturiexercisemittauspersoonallisuuden piirteetMiddle AgedTraitspersoonallisuusleisure timeAccelerometeraccelerometerlcsh:RC952-954.6Cross-Sectional Studiespersonalitymittarit (mittaus)FemaleSelf ReportLeisure timevapaa-aikafyysinen aktiivisuusResearch ArticlePersonalityBMC Geriatrics
researchProduct

supplement_material – Supplemental material for Effects of an individually targeted multicomponent counseling and home-based rehabilitation program o…

2020

Supplemental material, supplement_material for Effects of an individually targeted multicomponent counseling and home-based rehabilitation program on physical activity and mobility in community-dwelling older people after discharge from hospital: a randomized controlled trial by Katri M Turunen, Laura Aaltonen-Määttä, Timo Törmäkangas, Timo Rantalainen, Erja Portegijs, Sirkka Keikkala, Marja-Liisa Kinnunen, Taija Finni, Sarianna Sipilä and Riku Nikander in Clinical Rehabilitation

FOS: Clinical medicine110604 Sports MedicineFOS: Health sciences110904 Neurology and Neuromuscular Diseases110314 Orthopaedics
researchProduct

Bone mineral density, structure, distribution and strength in men with prostate cancer treated with androgen deprivation therapy

2019

Androgen deprivation therapy (ADT) improves survival in men with advanced prostate cancer (PCa), but has been associated with compromised skeletal health and increased fracture risk. However, limited previous research has investigated determinants of bone strength beyond DXA-derived areal bone mineral density (aBMD) in this population group. The aim of this cross-sectional study was to investigate the effects of ADT in men with PCa on BMD, bone structure, estimates of whole bone strength and cortical bone distribution. A total of 70 ADT-treated men, 52 PCa controls and 70 healthy controls had DXA lumbar spine and proximal femur aBMD and pQCT distal (4%) and proximal (66%) tibia and radius c…

musculoskeletal diseasesbone distributionsyöpähoidoteturauhassyöpähormonihoitoluuntiheysandrogen deprivation therapybone strengthbone mineral densityluukudokset
researchProduct

The skeletal maturity of Australian children aged 10–13 years in 2016

2021

Skeletal maturity can be used as a biological indicator of the tempo of growth in children and adolescents. We present a description of skeletal maturity from a cohort of white Australian children and describe variation in skeletal maturity based on child age. Participants (n = 71; age 10.5–13.9 years) were recruited from the ‘Healthy, Active Preschool &amp; Primary Years (HAPPY)’ study. Left hand-wrist radiographs were used to determine skeletal maturity using the Tanner-Whitehouse III (TW3) RUS technique. In boys, the mean skeletal maturity offset (bone age – chronological age) was −0.12 ± 0.19 years and 57.9% had delayed skeletal maturity compared to chronological age. Among those with d…

researchProduct

Physical activity accumulation along the intensity spectrum differs between children and adults

2021

Purpose Detailed exploration of physical activity accumulation with fine grading along the intensity spectrum has indicated the potential pragmatic utility of such an approach. However, it is currently unclear what sorts of accumulation patterns along particular intensity bands are found in the children and adult populations. Therefore, we conducted a comparison of activity accumulation in specific intensity bands between four distinct populations: children, adults with sedentary lifestyles, habitual joggers, habitual marathon runners. Methods Free-living waist-worn accelerometry records from 28 children aged 7 to 11, and 61 adults aged 25 to 35 were analysed. Activity intensity was evaluat…

activityaktigrafialapset (ikäryhmät)mean amplitude deviationwearablefyysinen aktiivisuusaikuisetactigraphy
researchProduct

P 042 - Gait complexity quantified using inertial measurement units in children with cerebral palsy

2018

Children with cerebral palsy (CP) have various gait impairments, and consequently their gait is less stable compared to typically developed (TD) controls. Gait kinematics are also affected more in CP than TD by concurrent dual and cognitive tasks. Inertial measurement units (IMU) provide efficient tool to quantify gait stability, but the practical value of IMU based gait assessment has not been tested in children with CP. nonPeerReviewed

CP-oireyhtymächildrencerebral palsy (CP)CP-vammaisettasapainolapset (ikäryhmät)kehonhallinta
researchProduct

Mechanical loading influences the lumbar intervertebral disc : A cross‐sectional study in 308 athletes and 71 controls

2021

There is evidence in animal populations that loading and exercise can positively impact the intervertebral disc (IVD). However, there is a paucity of information in humans. We examined the lumbar IVDs in 308 young athletes across six sporting groups (baseball, swimming, basketball, kendo, soccer and running; mean age 19yrs) and 71 non‐athletic controls. IVD status was quantified via the ratio of IVD to vertebral body height (IVD hypertrophy) and ratio of signal intensity in the nucleus to that in the annulus signal (IVD nucleus hydration) on sagittal T2‐weighted MRI. P‐values were adjusted via the false discovery rate method to mitigate false positives. In examining the whole collective, co…

musculoskeletal diseasesnikamavälilevyexercisemagneettikuvausback painkipuliikuntamusculoskeletal systemspineselkäsairaudetmagnetic resonance imagingselkäintervertebral discsportshuman activitieslow back pain
researchProduct

Puettava teknologia valmennuksen tukena

2022

Sensoriteknologia on jo melko laajasti käytössä valmennuksessa. Lopullinen läpimurto on kuitenkin vasta tulossa. nonPeerReviewed

mobiililaitteetvalmennusmenetelmätmittarit (mittaus)älytekniikkaharjoitteluvalmennusliikeanalyysipuettava teknologiaanturiturheilusuoritukset
researchProduct

Increased Joint Mobility Is Associated With Impaired Transversus Abdominis Contraction

2022

Increased joint mobility is a risk factor for joint injury, but muscle function may be able to compensate for it. Current evidence suggests reduced force production capacity in people with hypermobility. However, little is known about the lumbar spine. The purpose of this cross-sectional study was to assess whether there was a link between joint mobility and transverse abdominis and multifidus muscles contraction, muscles ascribed a core-stability role. Using a modified quantitative version of the Beighton scale (BOM score), we measured joint mobility of 30 middle-aged individuals without low back pain. These scores were correlated with magnetic resonance imaging–derived measures of transve…

urheiluvammatmusclelaxityphysical therapylihaksetkuntoutusfaskiatphysiotherapyfasciafysioterapiayliliikkuvuusrehabilitation
researchProduct

Musification of Accelerometry Data Towards Raising Awareness of Physical Activity

2022

Previous research has shown that the temporal dynamics of human activity recorded by accelerometers share a similar structure with music. This opens the possibility to use musical sonification of accelerometry data to raise awareness of daily physical activity. In this study a method was developed for quantifying the daily structure of human activity using multigranular temporal segmentation, and applying it to produce musical sonifications. Two accelerometry recordings of physical activity were selected from a dataset, such that one shows more physical activity than the other. These data were segmented in different time-scales so that segmentation boundaries at a given time-scale have a co…

joutilaisuussegmentationmusiikkisonificationliikuntadailyphysicalkiihtyvyysfyysinen aktiivisuus
researchProduct

Count‐ versus MAD‐based accelerometry‐assessed movement behaviors and associations with child adiposity and fitness

2021

Estimations of time spent sedentary and in various physical activity intensities may vary according to data reduction methods applied. This study compared associations between children’s accelerometer data and adiposity and fitness markers using open source (mean amplitude deviation; MAD) and proprietary (counts) data reduction methods. Complete-case accelerometer, adiposity (Body Mass Index z-score, waist circumference), and fitness (cardiorespiratory, musculoskeletal) data from 118 children (10.4±0.6 years, 49% girls) were analysed. Estimates of sedentary behaviour, light-, moderate-, vigorous- (VPA) and moderate- to vigorous-intensity (MVPA) physical activity were calculated using count-…

fyysinen kuntolapset (ikäryhmät)fyysinen aktiivisuuskehonkoostumusmittausmenetelmät
researchProduct

Comparison of Classroom-based Sedentary Time and Physical Activity in Conventional Classrooms and Open Learning Spaces Among Elementary School Studen…

2021

European children and adolescents spend most of their daily life and especially their school hours being sedentary which may increase their risk for chronic non-communicable diseases later in life. After the curriculum reform of Finnish basic education in 2014, most of the new or renovated comprehensive schools in Finland incorporate open and flexible classroom designs. Their open learning spaces may provide students opportunities to reduce sedentary behavior during school hours. Thus, waist-worn accelerometers were used to assess classroom-based sedentary time (ST), the number of breaks from sedentary time (BST), and physical activity (PA) among cross-sectional samples of 3rd and 5th grade…

opetustilatkoulutclassroomphysical activitylapset (ikäryhmät)General Medicineliikuntaistuminenopen learning spacenuoretSports and Active Livingsedentary behaviorelementary schooltauotfyysinen aktiivisuusOriginal Researchbreaks from sedentary timeopetussuunnitelmat
researchProduct

Physical function and lean body mass as predictors of bone loss after hip fracture: a prospective follow-up study

2020

Abstract Background: Predictors of bone deterioration after hip fracture have not been well characterized. The aim of this study was to examine the associations of physical function and lean body mass (LBM) with loss of bone density and strength in older people recovering from a hip fracture. Methods: A total of 81 over 60-year-old, community-dwelling men and women operated for a hip fracture participated in this 1-year prospective follow-up study. Distal tibia total volumetric bone mineral density (vBMDTOT, mg/cm³) and compressive strength index (BSI, g²/cm⁴) and mid-tibia cortical vBMD (vBMDCO, mg/cm³) and bending strength index (SSI, mm³) were assessed in both legs by peripheral quantita…

MaleAginglcsh:Diseases of the musculoskeletal systemfyysinen toimintakykyluuntiheysWalkingHip fracturemurtumatBone DensityBone mineral densityHumansProspective StudiespQCTAgedAged 80 and overTibiaHip FracturesMiddle AgedPhysical Functional PerformancelonkkaBone Diseases MetabolicikääntyminenlihasmassaLean body massMultivariate AnalysisBody CompositionLinear ModelsPhysical functionFemaleIndependent Livinglcsh:RC925-935human activitiesResearch ArticleFollow-Up StudiesBMC Musculoskeletal Disorders
researchProduct

Active aging – resilience and external support as modifiers of the disablement outcome: AGNES cohort study protocol

2018

Background: Population aging increases the need for knowledge on positive aspects of aging, and contributions of older people to their own wellbeing and that of others. We defined active aging as an individual’s striving for elements of wellbeing with activities as per their goals, abilities and opportunities. This study examines associations of health, health behaviors, health literacy and functional abilities, environmental and social support with active aging and wellbeing. We will develop and validate assessment methods for physical activity and physical resilience suitable for research on older people, and examine their associations with active aging and wellbeing. We will examine coho…

MaleaktiivisuusAgingympäristöhyvinvointiHealth BehaviorEnvironmentfunctioningCohort StudiesStudy ProtocolwellbeingvammaisuustoimintakykyHumansDisabled PersonsFunctioningExerciseFinlandAgedAged 80 and overMobilityLower extremityDisabilityexerciseWellbeinglcsh:Public aspects of medicineagingCohortSocial Supportlcsh:RA1-1270cohortResilience PsychologicalHealth LiteracyActivityikääntyminenliikkuvuuslower extremityFemalefyysinen aktiivisuusBMC Public Health
researchProduct