0000000000148838

AUTHOR

Stefano Omboni

0000-0002-7124-2096

showing 18 related works from this author

Early Treatment With Zofenopril and Ramipril in Combination With Acetyl Salicylic Acid in Patients With Left Ventricular Systolic Dysfunction After A…

2017

Abstract: The SMILE-4 study showed that in patients with left ventricular dysfunction (LVD) after acute myocardial infarction, early treatment with zofenopril plus acetyl salicylic acid is associated with an improved 1-year survival, free from death or hospitalization for cardiovascular (CV) causes, as compared to ramipril plus acetyl salicylic acid. We now report CV outcomes during a 5-year follow-up of the patients of the SMILE-4 study. Three hundred eighty-six of the 518 patients completing the study (51.2%) could be tracked after the study end and 265 could be included in the analysis. During the 5.5 (±2.1) years of follow-up, the primary endpoint occurred in 27.8% of patients originall…

MaleCaptoprilTime FactorsMyocardial InfarctionAngiotensin-Converting Enzyme InhibitorsKaplan-Meier Estimate030204 cardiovascular system & hematologyVentricular Function Leftchemistry.chemical_compoundVentricular Dysfunction Left0302 clinical medicineRetrospective StudieRisk FactorsClinical endpointOdds Ratiozofenopril030212 general & internal medicineMyocardial infarctionRandomized Controlled Trials as Topicleft ventricular dysfunctionMortality ratePharmacology; Cardiology and Cardiovascular MedicineMiddle AgedZofenoprilHospitalizationTreatment OutcomeCardiologyOriginal ArticleDrug Therapy CombinationFemaleCardiology and Cardiovascular MedicineHumanmedicine.drugRamiprilmedicine.medical_specialtyLogistic ModelTime FactorSystoleacute myocardial infarctionramiprilDisease-Free SurvivalDrug Administration ScheduleFollow-Up Studie03 medical and health sciencesStatistical significanceInternal medicineEarly Medical InterventionmedicineHumansIntensive care medicineAgedRetrospective StudiesPharmacologyChi-Square DistributionAspirinbusiness.industryRisk FactorAngiotensin-Converting Enzyme InhibitorOdds ratioRecovery of Functionmedicine.diseaseConfidence intervalLogistic ModelschemistryClinical Trials Phase III as Topicbusinessacetyl salicylic acidFollow-Up StudiesJournal of Cardiovascular Pharmacology
researchProduct

European Society of Hypertension practice guidelines for ambulatory blood pressure monitoring

2014

Given the increasing use of ambulatory blood pressure monitoring (ABPM) in both clinical practice and hypertension research, a group of scientists, participating in the European Society of Hypertension Working Group on blood pressure monitoring and cardiovascular variability, in year 2013 published a comprehensive position paper dealing with all aspects of the technique, based on the available scientific evidence for ABPM. The present work represents an updated schematic summary of the most important aspects related to the use of ABPM in daily practice, and is aimed at providing recommendations for proper use of this technique in a clinical setting by both specialists and practicing physici…

AdultMalemedicine.medical_specialtyAmbulatory blood pressureAdolescentPhysiologyMEDLINEPharmacyWhite coat hypertensionPractice PatternsBlood Pressure MonitoringMasked HypertensionAtrial FibrillationAmbulatoryInternal MedicinemedicineHumansambulatory blood pressure monitoring arterial hypertension clinic blood pressure measurement clinical indications guidelines home blood pressure measurement practice recommendationsObesityPractice Patterns Physicians'ChildIntensive care medicineReimbursementPhysicians'business.industryMED/11 - MALATTIE DELL'APPARATO CARDIOVASCOLAREBlood Pressure Monitoring Ambulatorymedicine.disease3. Good healthMasked HypertensionBlood pressureHypertensionPosition paperFemaleCardiology and Cardiovascular MedicinebusinessSoftwareWhite Coat HypertensionJournal of Hypertension
researchProduct

Zofenopril and Ramipril in Combination with Acetyl Salicylic Acid in Postmyocardial Infarction Patients with Left Ventricular Systolic Dysfunction: A…

2016

Summary Objective In the SMILE-4 study, zofenopril + acetyl salicylic acid (ASA) was more effective than ramipril + ASA on 1-year prevention of major cardiovascular events (MACE) in patients with acute myocardial infarction complicated by left ventricular dysfunction. In this retrospective analysis, we evaluated drug efficacy in subgroups of patients, according to a history of diabetes mellitus. Methods The primary study endpoint was 1-year combined occurrence of death or hospitalization for cardiovascular causes. Diabetes was defined according to medical history (previous known diagnosis). Results A total of 562 of 693 (81.0%) patients were classified as nondiabetics and 131 (18.9%) as dia…

MaleCaptoprilDiabetic CardiomyopathiesMyocardial InfarctionInfarctionAngiotensin-Converting Enzyme Inhibitors030204 cardiovascular system & hematologychemistry.chemical_compoundVentricular Dysfunction Left0302 clinical medicineDiabetes mellitusRamiprilRetrospective StudieCardiovascular DiseaseMedicinePharmacology (medical)030212 general & internal medicineMyocardial infarctionDiabetic CardiomyopathieRandomized Controlled Trials as TopicAspirinLeft ventricular dysfunctionGeneral MedicineAcetyl salicylic acid; Acute myocardial infarction; Angiotensin-converting enzyme inhibitors; Diabetes mellitus; Left ventricular dysfunction; Ramipril; Zofenopril; Cardiology and Cardiovascular Medicine; Pharmacology (medical); PharmacologyMiddle AgedZofenoprilAcetyl salicylic acidCardiovascular DiseasesCardiologyPlatelet aggregation inhibitorDrug Therapy CombinationFemaleCardiology and Cardiovascular Medicinemedicine.drugHumanRamiprilmedicine.medical_specialtyDiabetes mellituSystoleAcute myocardial infarctionZofenopril03 medical and health sciencesDiabetes mellitusInternal medicineHumansAgedRetrospective StudiesPharmacologyAspirinbusiness.industryPlatelet Aggregation InhibitorAngiotensin-Converting Enzyme Inhibitormedicine.diseasechemistryAngiotensin-converting enzyme inhibitorbusinessMacePlatelet Aggregation Inhibitors
researchProduct

Zofenopril and ramipril in patients with left ventricular systolic dysfunction after acute myocardial infarction: A propensity analysis of the Surviv…

2016

Introduction: This was a propensity score analysis of the prospective, randomized, double-blind Survival of Myocardial Infarction Long-term Evaluation (SMILE) 4 study in which one-year treatment with zofenopril 60 mg plus acetylsalicylic acid (ASA) 100 mg gave superior results compared to ramipril 10 mg plus ASA in terms of death or hospitalization for cardiovascular causes in patients with acute myocardial infarction (AMI) complicated by left ventricular dysfunction (LVD). Materials and methods: A total of 716 patients of the intention-to-treat population were divided into homogeneous propensity quintiles (Q) using a logistic regression model (QI: best risk profile; QV: worst risk profile)…

MaleMedicine (General)Time FactorsCaptoprilIntention to Treat AnalysiLeftMyocardial Infarction030204 cardiovascular system & hematologychemistry.chemical_compoundVentricular Dysfunction Left0302 clinical medicineEndocrinologyRamiprilPropensity analysisAcetylsalicylic acid; Acute myocardial infarction; Angiotensin-converting enzyme inhibitors; Left ventricular dysfunction; Propensity analysis; Captopril; Demography; Drug Therapy Combination; Endpoint Determination; Female; Hospitalization; Humans; Intention to Treat Analysis; Male; Middle Aged; Myocardial Infarction; Ramipril; Survival Analysis; Time Factors; Ventricular Dysfunction Left; Propensity Score; Internal Medicine; EndocrinologyVentricular DysfunctionMedicine030212 general & internal medicineMyocardial infarctioneducation.field_of_studyLeft ventricular dysfunctionElectrocardiography in myocardial infarctionMiddle AgedZofenoprilIntention to Treat AnalysisHospitalizationCombinationCardiologyOriginal ArticleDrug Therapy CombinationFemaleSurvival AnalysiPropensity analysimedicine.drugHumanRamiprilmedicine.medical_specialtyTime FactorEndpoint DeterminationPopulationAcute myocardial infarction03 medical and health sciencesR5-920Drug TherapyInternal medicineAngiotensin-converting enzyme inhibitorsAcetylsalicylic acidInternal MedicineHumanseducationPropensity ScoreDemographybusiness.industryOdds ratiomedicine.diseaseSurvival AnalysisConfidence intervalchemistryAngiotensin-converting enzyme inhibitorPropensity score matchingbusiness
researchProduct

Cost-effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post hoc analysis of SMI…

2013

Claudio Borghi,1 Ettore Ambrosioni,1 Stefano Omboni,2 Arrigo FG Cicero,1 Stefano Bacchelli,1 Daniela Degli Esposti,1 Salvatore Novo,3 Dragos Vinereanu,4 Giuseppe Ambrosio,5 Giorgio Reggiardo,6 Dario Zava7 1Unit of Internal Medicine, Policlinico S Orsola, University of Bologna, Bologna, Italy; 2Italian Institute of Telemedicine, Varese, Italy; 3Division of Cardiology, University of Palermo, Palermo, Italy; 4University and Emergency Hospital, Bucharest, Romania; 5Division of Cardiology, University of Perugia, Perugia, Italy; 6Mediservice, Milano, Italy; 7Istituto Lusofarmaco d'Italia SpA, Peschiera Borromeo, Italy Background: In SMILE-4 (the Survival of Myocardial Infarction Long-term…

Ramiprilmedicine.medical_specialtyCost effectivenessEconomics Econometrics and Finance (miscellaneous)Populationacute myocardial infarctionramiprilchemistry.chemical_compoundInternal medicinePost-hoc analysismedicinezofenoprilMyocardial infarctioneducationcost-effectivenesshealth care economics and organizationsOriginal Researchleft ventricular dysfunctioneducation.field_of_studylcsh:R5-920business.industryHealth Policylcsh:RM1-950acetylsalicylic acidmedicine.diseaseSMILE studycost effectiveness analysis (CEA)Confidence intervalZofenoprilangiotensin-converting enzyme inhibitorsClinicoEconomics and Outcomes Researchlcsh:Therapeutics. PharmacologychemistryCardiologyNumber needed to treatMedical emergencybusinesslcsh:Medicine (General)medicine.drug
researchProduct

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct

Randomised comparison of zofenopril and ramipril plus acetylsalicylic acid in postmyocardial infarction patients with left ventricular systolic dysfu…

2015

Objective Conflicting evidence exists on the benefits of treating patients with coronary artery disease and preserved left ventricular ejection fraction (LVEF) with an ACE inhibitor. This retrospective analysis of the SMILE-4 Study sought to compare the efficacy of zofenopril 60 mg plus acetylsalicylic acid (ASA) versus ramipril 10 mg plus ASA 100 mg in patients with acute myocardial infarction (AMI) and heart failure, according to an impaired or preserved LVEF. Methods The primary study end point was 1-year combined occurrence of death or hospitalisation for cardiovascular causes. A preserved LVEF was defined by a baseline LVEF >40% and an impaired one by an LVEF ≤40%. Results 448 patients…

Ramiprilmedicine.medical_specialtyacute myocardial infarctionInfarctionramiprilCoronary Artery DiseaseCoronary artery diseasechemistry.chemical_compoundInternal medicinemedicinezofenopril1506cardiovascular diseasesMyocardial infarctionleft ventricular dysfunctionEjection fractionbusiness.industryleft ventricular ejection fractionmedicine.diseaseZofenoprilangiotensin-converting enzyme inhibitorsangiotensin-converting enzyme inhibitorchemistryacute myocardial infarction; angiotensin-converting enzyme inhibitors; left ventricular dysfunction; left ventricular ejection fractionHeart failureACE inhibitorcardiovascular systemCardiologyCardiology and Cardiovascular Medicinebusinesscirculatory and respiratory physiologyBiomedical engineeringmedicine.drugOpen Heart
researchProduct

Vascular Health Assessment of The Hypertensive Patients (VASOTENS) Registry: Study Protocol of an International, Web-Based Telemonitoring Registry fo…

2016

Background: Hypertension guidelines recommend ambulatory blood pressure (ABP), central aortic pressure (CAP), and pulse wave velocity (PWV) as parameters for estimating blood pressure (BP) control and vascular impairment. Recent advances in technology have enabled devices to combine non-invasive estimation of these parameters over the 24-hour ABP monitoring. However, currently there is limited evidence on the usefulness of such an approach for routine hypertension management. Objective: We recently launched an investigator-initiated, international, multicenter, observational, prospective study, the Vascular health Assessment Of The Hypertensive patients (VASOTENS) Registry, aimed at (1) eva…

medicine.medical_specialtyTelemedicineAmbulatory blood pressureSettore MED/09 - Medicina Internacentral aortic pressurehypertensionpulse wave velocity030204 cardiovascular system & hematologyaugmentation index03 medical and health sciences0302 clinical medicinearterial stiffneProtocolMedicine030212 general & internal medicineProspective cohort studyPulse wave velocitySettore MED/14 - Nefrologiablood pressure telemonitoringbusiness.industryblood pressure telemonitoring; arterial stiffness; pulse wave velocity; augmentation index; central aortic pressure; hypertensionGeneral Medicinemedicine.diseaseSurgeryBlood pressurearterial stiffnessEmergency medicinearterial stiffness; augmentation index; blood pressure telemonitoring; central aortic pressure; hypertension; pulse wave velocityAortic pressureArterial stiffnessObservational studybusinessJMIR Research Protocols
researchProduct

Suggested randomized, controlled trial for frovatriptan: a reply

2011

Dear Sir, We read with interest the comments of Dr. Tfelt-Hansen [1] regarding our three recently published randomized controlled trials comparing patients’ preference (primary endpoint) and efficacy (secondary endpoints) of frovatriptan 2.5 mg versus zolmitriptan 2.5 mg [2], rizatriptan 10 mg [3] and almotriptan 12.5 mg [4], and the meta-analysis of pooled individual data from the three studies [5]. In all studies frovatriptan showed similar preference and short-term efficacy outcomes (pain relief and pain-free episodes at 2 h) with respect to the other three triptans. The questions put by Dr. Tfelt-Hansen sound appropriate. Doubts are raised on the usefulness of head-to-head preference tr…

medicine.medical_specialtybusiness.industryClinical NeurologyZolmitriptanGeneral MedicineTriptansmedicine.diseaseRizatriptanEfficacySumatriptanAnesthesiology and Pain MedicineMigraineAlmotriptanmedicinefrovatriptan controlled trial migraineNeurology (clinical)Intensive care medicinebusinessFrovatriptanLetter to the Editormedicine.drugThe Journal of Headache and Pain
researchProduct

A double-blind, randomized, multicenter, Italian study of frovatriptan versus almotriptan for the acute treatment of migraine

2011

The objective of this study was to evaluate patients’ satisfaction with acute treatment of migraine with frovatriptan or almotriptan by preference questionnaire. One hundred and thirty three subjects with a history of migraine with or without aura (IHS 2004 criteria), with at least one migraine attack in the preceding 6 months, were enrolled and randomized to frovatriptan 2.5 mg or almotriptan 12.5 mg, treating 1–3 attacks. The study had a multicenter, randomized, double blind, cross-over design, with treatment periods lasting <3 months. At study end patients assigned preference to one of the treatments using a questionnaire with a score from 0 to 5 (primary endpoint). Secondary endpoints w…

AdultMaleAdolescentOriginalMigraine with AuraPopulationAlmotriptanCarbazolesClinical NeurologyMigraine; almotriptan; FrovatriptanYoung Adultalmotriptan; frovatriptan; migraine; patient preferenceDouble-Blind MethodAlmotriptanmedicineHumansMigraine Frovatriptan Almotriptan Patient preferencePatient preferenceeducationMigraineAgededucation.field_of_studyCross-Over Studiesbusiness.industryGeneral MedicineMiddle Agedmedicine.diseaseCrossover studyRizatriptanTryptaminesMigraine with auraSerotonin Receptor AgonistsalmotriptanTreatment OutcomeAnesthesiology and Pain MedicineItalyMigraineTolerabilityAnesthesiaAcute DiseaseFemaleSettore MED/26 - NeurologiaNeurology (clinical)medicine.symptombusinessFrovatriptanFrovatriptanmedicine.drug
researchProduct

Methodology and technology for peripheral and central blood pressure and blood pressure variability measurement: current status and future directions…

2016

Office blood pressure measurement has been the basis for hypertension evaluation for almost a century. However, the evaluation of blood pressure out of the office using ambulatory or self-home monitoring is now strongly recommended for the accurate diagnosis in many, if not all, cases with suspected hypertension. Moreover, there is evidence that the variability of blood pressure might offer prognostic information that is independent of the average blood pressure level. Recently, advancement in technology has provided noninvasive evaluation of central (aortic) blood pressure, which might have attributes that are additive to the conventional brachial blood pressure measurement. This position …

Position statementmedicine.medical_specialtyAmbulatory blood pressurePhysiologycentral blood pressureBlood Pressureclinic blood pressure030204 cardiovascular system & hematologylaw.inventionperipheral blood pressure03 medical and health sciences0302 clinical medicineCentral blood pressurelawaortic blood pressuremedicineInternal MedicineHumansBlood pressure monitoring030212 general & internal medicineIntensive care medicineambulatory blood pressureSocieties Medicalbrachial blood pressurebusiness.industryself-measurementMedicine (all)Blood Pressure DeterminationPeripheralEuropemonitoringPressure measurementBlood pressurePractice Guidelines as TopicAmbulatoryblood pressure variabilitymeasurementbusinessCardiology and Cardiovascular Medicine
researchProduct

MASked-unconTrolled hypERtension management based on office BP or on ambulatory blood pressure measurement (MASTER) Study: a randomised controlled tr…

2018

Introduction Masked uncontrolled hypertension (MUCH) carries an increased risk of cardiovascular (CV) complications and can be identified through combined use of office (O) and ambulatory (A) blood pressure (BP) monitoring (M) in treated patients. However, it is still debated whether the information carried by ABPM should be considered for MUCH management. Aim of the MASked-unconTrolled hypERtension management based on OBP or on ambulatory blood pressure measurement (MASTER) Study is to assess the impact on outcome of MUCH management based on OBPM or ABPM. Methods and analysis MASTER is a 4-year prospective, randomised, open-label, blinded-endpoint investigation. A total of 1240 treated hyp…

HYPERTENSION MANAGEMENTHipertensión.1302masked uncontrolled hypertensionEnfermedades cardiovasculares - Pacientes - Factores de riesgo.office blood pressureMASKED UNCONTROLLED HYPERTENSIONMedicina ClínicaCardiovascular Medicine030204 cardiovascular system & hematologyAMBULATORY BLOOD PRESSURE MONITORINGlaw.invention0302 clinical medicineClinical trialsRandomized controlled triallawBlood Pressure MonitoringMasked Hypertension//purl.org/becyt/ford/3.2 [https]ProtocolMulticenter Studies as Topic1506030212 general & internal medicineCardiovascular system - Diseases - Patients - Risk factors.Blood pressure.OFFICE BLOOD PRESSURERandomized Controlled Trials as TopicSistemas Cardíaco y CardiovascularGeneral MedicineBlood Pressure Monitoring Ambulatory3. Good healthCor MalaltiesEchocardiographyAmbulatoryHypertensionBlood pressure//purl.org/becyt/ford/3 [https]Hipertensióambulatory blood pressure monitoring; hypertension; hypertension management; masked uncontrolled hypertension; office blood pressure; treated hypertensive patientsTREATED HYPERTENSIVE PATIENTS1683medicine.medical_specialtyAmbulatory blood pressureCIENCIAS MÉDICAS Y DE LA SALUDhypertensionHeart Ventriclestreated hypertensive patientPressió sanguínia03 medical and health sciencesAmbulatoryHypertension.medicineAlbuminuriaHumansAntihypertensive AgentsProtocol (science)business.industryConsolidated Standards of Reporting Trialsambulatory blood pressure monitoring; hypertension; hypertension management; masked uncontrolled hypertension; office blood pressure; treated hypertensive patients; Albuminuria; Antihypertensive Agents; Echocardiography; Heart Ventricles; Humans; Masked Hypertension; Multicenter Studies as Topic; Randomized Controlled Trials as Topic; Blood Pressure Monitoring Ambulatorytreated hypertensive patientsambulatory blood pressure monitoringBlood pressurePresión sanguínea.Good clinical practiceEmergency medicinebusinessDeclaration of Helsinkihypertension managementAssaigs clínicsBMJ Open
researchProduct

When to use frovatriptan in migraine? A reply

2011

Dear Sir, We read with interest the comments of Dr. Tfelt-Hansen [1] on the two recently published randomized controlled trials comparing patients’ preference (primary end-point) and efficacy (secondary end-points) of frovatriptan with respect to rizatriptan [2] and almotriptan [3]. In both studies, frovatriptan showed similar preference and short-term efficacy outcomes (pain relief and pain free episodes at 2 h) with respect to the other two triptans. The principal concern of Dr. Tfelt-Hansen was the very early use of frovatriptan in these studies, making their results hardly comparable with those of previous randomized controlled trials [4–6], where patients waited until the headache was …

medicine.medical_specialtybusiness.industryClinical NeurologyGeneral MedicineTriptansPlacebomedicine.diseaseRizatriptanlaw.inventionSumatriptanAnesthesiology and Pain MedicineRandomized controlled trialMigrainelawAlmotriptanInternal medicineMedicineMigraine Frovatriptan Almotriptan Patient preferenceNeurology (clinical)businessPsychiatryFrovatriptanLetter to the Editormedicine.drug
researchProduct

Efficacy and Safety of Zofenopril Versus Ramipril in the Treatment of Myocardial Infarction and Heart Failure: A Review of the Published and Unpublis…

2018

Zofenopril is a lipophilic, sulfhydryl group-containing angiotensin-converting enzyme (ACE)-inhibitor, characterized by wide tissue distribution, long duration of action, and pleiotropic effects on endothelial dysfunction. Its clinical efficacy and safety have been described in the four randomized controlled trials of the SMILE program, which globally enrolled more than 3600 patients in post-acute myocardial infarction (AMI) setting. The SMILE-4 study specifically selected patients with left ventricular dysfunction at admission, and compared the effects of zofenopril or ramipril in combination with acetylsalicylic acid (ASA). Zofenopril demonstrated its superiority over ramipril in reducing…

0301 basic medicineRamiprilmedicine.medical_specialtyCaptoprilPopulationMyocardial InfarctionCardiologyAngiotensin-Converting Enzyme InhibitorsHeart failureReviewAcute myocardial infarction030204 cardiovascular system & hematologylaw.inventionZofenopril03 medical and health scienceschemistry.chemical_compound0302 clinical medicineRandomized controlled trialDouble-Blind MethodRamiprillawInternal medicineAcute myocardial infarction; Angiotensin-converting enzyme inhibitors; Cardiology; Heart failure; Left ventricular dysfunction; Ramipril; Zofenopril; Pharmacology (medical)MedicineHumansPharmacology (medical)Myocardial infarctioneducationRandomized Controlled Trials as Topiceducation.field_of_studyLeft ventricular dysfunctionEjection fractionbusiness.industryGeneral Medicinemedicine.diseaseZofenopril030104 developmental biologyTreatment OutcomechemistryAngiotensin-converting enzyme inhibitorHeart failureCardiologyNumber needed to treatbusinessmedicine.drug
researchProduct

Frovatriptan vs almotriptan for treatment of menstrual migraine: a double-blind, randomized, cross-over, multicenter Italian study

2013

Results 67 of the 96 female patients of the intention-to-treat population of the main study had regular menstrual cycles and were thus included in this subgroup analysis. 77 migraine attacks classified as related to menses were treated with frovatriptan and 78 with almotriptan. Rate of pain relief at 2and 4-hrs was 36% and 53% for frovatriptan and 41% and 50% for almotriptan (p=NS between treatments). Rate of pain free at 2and 4-hrs was 19% and 47% with frovatriptan and 29% and 54% for almotriptan (p=NS). At 24-hrs, 62% of frovatriptanand 67% of almotriptan-treated patients had pain relief, while 60% vs. 67% were pain free (p=NS). Recurrence at 24-hrs was significantly (p<0.05) lower with f…

medicine.medical_specialtyeducation.field_of_studyTraditional medicinebusiness.industrymedia_common.quotation_subjectPopulationPain reliefClinical NeurologySubgroup analysisGeneral Medicinemedicine.diseaseAnesthesiology and Pain MedicineMigraineInternal medicineAlmotriptanFemale patientPoster PresentationmedicineNeurology (clinical)FrovatriptaneducationbusinessMenstrual cyclemedicine.drugmedia_commonThe Journal of Headache and Pain
researchProduct

Zofenopril is a cost-effective treatment for patients with left ventricular systolic dysfunction following acute myocardial infarction: a pharmacoeco…

2013

Objective: The Survival of Myocardial Infarction Long-term Evaluation 4 Study (SMILE-4) showed the superiority of Zofenopril (Z) associated with Acetylsalicylic Acid (ASA) as respect to Ramipril (R) plus ASA in reducing the occurrence of major cardiovascular events, in patients with left ventricular dysfunction (LVD) following Acute Myocardial Infarction (AMI). The objective of this retrospective analysis was the evaluation of cost-effectiveness of Z compared to R. Methods: 771 patients with LVD and AMI were randomized, double-blind to Z 60 mg/day (n=389) or R 10 mg/day (n=382) plus ASA 100 mg/day and followed-up for 1 year. The primary study end-point was 1-year combined occurrence of deat…

RamiprilPediatricsmedicine.medical_specialtyeducation.field_of_studybusiness.industryCost effectivenessSurrogate endpointPopulationmedicine.diseaseConfidence intervalZofenoprilchemistry.chemical_compoundchemistryInternal medicinemedicineCardiologyNumber needed to treatMyocardial infarctionCardiology and Cardiovascular Medicinebusinesseducationhealth care economics and organizationsmedicine.drugEuropean Heart Journal
researchProduct

European society of hypertension position paper on ambulatory blood pressure monitoring

2013

Ambulatory blood pressure monitoring (ABPM) is being used increasingly in both clinical practice and hypertension research. Although there are many guidelines that emphasize the indications for ABPM, there is no comprehensive guideline dealing with all aspects of the technique. It was agreed at a consensus meeting on ABPM in Milan in 2011 that the 34 attendees should prepare a comprehensive position paper on the scientific evidence for ABPM.This position paper considers the historical background, the advantages and limitations of ABPM, the threshold levels for practice, and the cost-effectiveness of the technique. It examines the need for selecting an appropriate device, the accuracy of dev…

Arterial hypertensionmedicine.medical_specialtyAmbulatory blood pressurePhysiologyMEDLINEWhite coat hypertension030204 cardiovascular system & hematologylaw.invention03 medical and health sciencesresearch application0302 clinical medicineRandomized controlled triallawInternal Medicinemedicine030212 general & internal medicineguidelinesIntensive care medicineambulatory blood pressure monitoring clinic blood pressure measurement clinical indications guidelines home blood pressure measurement recommendations research applicationReimbursementbusiness.industryGuidelinemedicine.diseasehome blood pressure measurement3. Good healthMasked Hypertensionambulatory blood pressure monitoringrecommendationsPosition paperclinic blood pressure measurementCardiology and Cardiovascular Medicinebusinessclinical indications
researchProduct

Variable association of 24-h peripheral and central hemodynamics and stiffness with hypertension-mediated organ damage: the VASOTENS Registry.

2020

Objective In this analysis of the telehealth-based Vascular health ASsessment Of The hypertENSive patients Registry, we checked how 24-h central and peripheral hemodynamics compare with hypertension-mediated organ damage (HMOD). Methods In 646 hypertensive patients (mean age 52 ± 16 years, 54% males, 65% treated) we obtained ambulatory brachial and central SBP and pulse pressure (PP), SBP, and PP variability, pulse wave velocity and augmentation index with a validated cuff-based technology. HMOD was defined by an increased left ventricular mass index (cardiac damage, evaluated in 482 patients), an increased intima-media thickness (vascular damage, n = 368), or a decreased estimated glomerul…

AdultMalemedicine.medical_specialtySettore MED/09 - Medicina InternaPhysiologyarterial stiffness augmentation index blood pressure blood pressure telemonitoring central arterial pressure hypertension pulse wave velocity vascular biomarkersRenal functionHemodynamicsBlood Pressure030204 cardiovascular system & hematologyPulse Wave AnalysisKidneyCarotid Intima-Media Thickness03 medical and health sciences0302 clinical medicineInternal medicineInternal MedicinemedicineHumans030212 general & internal medicineRegistriesPulse wave velocityAgedSettore MED/14 - Nefrologiabusiness.industryHemodynamicsBlood Pressure DeterminationOdds ratioBlood Pressure Monitoring AmbulatoryMiddle Agedmedicine.diseasePulse pressureBlood pressureAmbulatoryHypertensionCardiologyArterial stiffnessFemaleCardiology and Cardiovascular MedicinebusinessGlomerular Filtration RateJournal of hypertension
researchProduct