0000000000320285

AUTHOR

Giuseppe Ambrosio

0000-0002-9677-980x

showing 12 related works from this author

Early Treatment With Zofenopril and Ramipril in Combination With Acetyl Salicylic Acid in Patients With Left Ventricular Systolic Dysfunction After A…

2017

Abstract: The SMILE-4 study showed that in patients with left ventricular dysfunction (LVD) after acute myocardial infarction, early treatment with zofenopril plus acetyl salicylic acid is associated with an improved 1-year survival, free from death or hospitalization for cardiovascular (CV) causes, as compared to ramipril plus acetyl salicylic acid. We now report CV outcomes during a 5-year follow-up of the patients of the SMILE-4 study. Three hundred eighty-six of the 518 patients completing the study (51.2%) could be tracked after the study end and 265 could be included in the analysis. During the 5.5 (±2.1) years of follow-up, the primary endpoint occurred in 27.8% of patients originall…

MaleCaptoprilTime FactorsMyocardial InfarctionAngiotensin-Converting Enzyme InhibitorsKaplan-Meier Estimate030204 cardiovascular system & hematologyVentricular Function Leftchemistry.chemical_compoundVentricular Dysfunction Left0302 clinical medicineRetrospective StudieRisk FactorsClinical endpointOdds Ratiozofenopril030212 general & internal medicineMyocardial infarctionRandomized Controlled Trials as Topicleft ventricular dysfunctionMortality ratePharmacology; Cardiology and Cardiovascular MedicineMiddle AgedZofenoprilHospitalizationTreatment OutcomeCardiologyOriginal ArticleDrug Therapy CombinationFemaleCardiology and Cardiovascular MedicineHumanmedicine.drugRamiprilmedicine.medical_specialtyLogistic ModelTime FactorSystoleacute myocardial infarctionramiprilDisease-Free SurvivalDrug Administration ScheduleFollow-Up Studie03 medical and health sciencesStatistical significanceInternal medicineEarly Medical InterventionmedicineHumansIntensive care medicineAgedRetrospective StudiesPharmacologyChi-Square DistributionAspirinbusiness.industryRisk FactorAngiotensin-Converting Enzyme InhibitorOdds ratioRecovery of Functionmedicine.diseaseConfidence intervalLogistic ModelschemistryClinical Trials Phase III as Topicbusinessacetyl salicylic acidFollow-Up StudiesJournal of Cardiovascular Pharmacology
researchProduct

Stress Echocardiography and Strain in Aortic Regurgitation (SESAR protocol): Left ventricular contractile reserve and myocardial work in asymptomatic…

2020

Objectives: To analyze left ventricular (LV) myocardial deformation and contractile reserve (CR) in asymptomatic patients with severe aortic regurgitation (AR) at rest and during exercise, and their correlation with functional capacity. Background: The natural history of chronic AR is characterized by a prolonged silent phase before onset of symptoms and overt LV dysfunction. Assessment of LV systolic function and contractile reserve has an important role in the decision-making of AR asymptomatic patients. Methods: Standard echo, lung ultrasound, and LV 2D speckle tracking strain were performed at rest and during exercise in asymptomatic patients with severe AR and in age- and sex-comparabl…

aortic regurgitation contractile reserve myocardial work stress echocardiography two-dimensional strainMalemedicine.medical_specialtyLongitudinal strainstress echocardiographyHeart VentriclesAortic Valve InsufficiencyStrain (injury)Regurgitation (circulation)030204 cardiovascular system & hematologyAsymptomatictwo-dimensional strainVentricular Function LeftHeart Ventricle03 medical and health sciencesVentricular Dysfunction Left0302 clinical medicineInternal medicinecontractile reserveEchocardiography StremedicineStress EchocardiographyHumansRadiology Nuclear Medicine and imaging030212 general & internal medicineSubclinical infectionEjection fractionbusiness.industryStroke Volumeaortic regurgitation; contractile reserve; myocardial work; stress echocardiography; two-dimensional strainmedicine.diseaseaortic regurgitationLung ultrasoundmyocardial workCardiologymedicine.symptomCardiology and Cardiovascular MedicinebusinessHumanEchocardiography StressEchocardiography (Mount Kisco, N.Y.)REFERENCES
researchProduct

Cost-effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post hoc analysis of SMI…

2013

Claudio Borghi,1 Ettore Ambrosioni,1 Stefano Omboni,2 Arrigo FG Cicero,1 Stefano Bacchelli,1 Daniela Degli Esposti,1 Salvatore Novo,3 Dragos Vinereanu,4 Giuseppe Ambrosio,5 Giorgio Reggiardo,6 Dario Zava7 1Unit of Internal Medicine, Policlinico S Orsola, University of Bologna, Bologna, Italy; 2Italian Institute of Telemedicine, Varese, Italy; 3Division of Cardiology, University of Palermo, Palermo, Italy; 4University and Emergency Hospital, Bucharest, Romania; 5Division of Cardiology, University of Perugia, Perugia, Italy; 6Mediservice, Milano, Italy; 7Istituto Lusofarmaco d'Italia SpA, Peschiera Borromeo, Italy Background: In SMILE-4 (the Survival of Myocardial Infarction Long-term…

Ramiprilmedicine.medical_specialtyCost effectivenessEconomics Econometrics and Finance (miscellaneous)Populationacute myocardial infarctionramiprilchemistry.chemical_compoundInternal medicinePost-hoc analysismedicinezofenoprilMyocardial infarctioneducationcost-effectivenesshealth care economics and organizationsOriginal Researchleft ventricular dysfunctioneducation.field_of_studylcsh:R5-920business.industryHealth Policylcsh:RM1-950acetylsalicylic acidmedicine.diseaseSMILE studycost effectiveness analysis (CEA)Confidence intervalZofenoprilangiotensin-converting enzyme inhibitorsClinicoEconomics and Outcomes Researchlcsh:Therapeutics. PharmacologychemistryCardiologyNumber needed to treatMedical emergencybusinesslcsh:Medicine (General)medicine.drug
researchProduct

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct

Randomised comparison of zofenopril and ramipril plus acetylsalicylic acid in postmyocardial infarction patients with left ventricular systolic dysfu…

2015

Objective Conflicting evidence exists on the benefits of treating patients with coronary artery disease and preserved left ventricular ejection fraction (LVEF) with an ACE inhibitor. This retrospective analysis of the SMILE-4 Study sought to compare the efficacy of zofenopril 60 mg plus acetylsalicylic acid (ASA) versus ramipril 10 mg plus ASA 100 mg in patients with acute myocardial infarction (AMI) and heart failure, according to an impaired or preserved LVEF. Methods The primary study end point was 1-year combined occurrence of death or hospitalisation for cardiovascular causes. A preserved LVEF was defined by a baseline LVEF >40% and an impaired one by an LVEF ≤40%. Results 448 patients…

Ramiprilmedicine.medical_specialtyacute myocardial infarctionInfarctionramiprilCoronary Artery DiseaseCoronary artery diseasechemistry.chemical_compoundInternal medicinemedicinezofenopril1506cardiovascular diseasesMyocardial infarctionleft ventricular dysfunctionEjection fractionbusiness.industryleft ventricular ejection fractionmedicine.diseaseZofenoprilangiotensin-converting enzyme inhibitorsangiotensin-converting enzyme inhibitorchemistryacute myocardial infarction; angiotensin-converting enzyme inhibitors; left ventricular dysfunction; left ventricular ejection fractionHeart failureACE inhibitorcardiovascular systemCardiologyCardiology and Cardiovascular Medicinebusinesscirculatory and respiratory physiologyBiomedical engineeringmedicine.drugOpen Heart
researchProduct

Serum uric acid and outcomes in patients with chronic heart failure through the whole spectrum of ejection fraction phenotypes: Analysis of the ESC-E…

2021

Background: Retrospective analyses of clinical trials indicate that elevated serum uric acid (sUA) predicts poor outcome in heart failure (HF). Uric acid can contribute to inflammation and microvascular dysfunction, which may differently affect different left ventricular ejection fraction (LVEF) phenotypes. However, role of sUA across LVEF phenotypes is unknown. Objectives: We investigated sUA association with outcome in a prospective cohort of HF patients stratified according to LVEF. Methods: Through the Heart Failure Long-Term Registry of the European Society of Cardiology (ESC-EORP-HFLT), 4,438 outpatients were identified and classified into: reduced (= 50% HFpEF) LVEF. Endpoints were t…

medicine.medical_specialtyHeart failure030204 cardiovascular system & hematologyVentricular Function Left03 medical and health scienceschemistry.chemical_compound0302 clinical medicineInternal medicineInternal MedicinemedicineHumansIn patient030212 general & internal medicineProspective StudiesRegistriesProspective cohort studyRetrospective StudiesInflammationEjection fractionbusiness.industryStroke Volumemedicine.diseasePrognosisClinical trialPhenotypechemistryQuartileHeart failureCohortCardiologyUric acidbusinessUric acid
researchProduct

Efficacy and Safety of Zofenopril Versus Ramipril in the Treatment of Myocardial Infarction and Heart Failure: A Review of the Published and Unpublis…

2018

Zofenopril is a lipophilic, sulfhydryl group-containing angiotensin-converting enzyme (ACE)-inhibitor, characterized by wide tissue distribution, long duration of action, and pleiotropic effects on endothelial dysfunction. Its clinical efficacy and safety have been described in the four randomized controlled trials of the SMILE program, which globally enrolled more than 3600 patients in post-acute myocardial infarction (AMI) setting. The SMILE-4 study specifically selected patients with left ventricular dysfunction at admission, and compared the effects of zofenopril or ramipril in combination with acetylsalicylic acid (ASA). Zofenopril demonstrated its superiority over ramipril in reducing…

0301 basic medicineRamiprilmedicine.medical_specialtyCaptoprilPopulationMyocardial InfarctionCardiologyAngiotensin-Converting Enzyme InhibitorsHeart failureReviewAcute myocardial infarction030204 cardiovascular system & hematologylaw.inventionZofenopril03 medical and health scienceschemistry.chemical_compound0302 clinical medicineRandomized controlled trialDouble-Blind MethodRamiprillawInternal medicineAcute myocardial infarction; Angiotensin-converting enzyme inhibitors; Cardiology; Heart failure; Left ventricular dysfunction; Ramipril; Zofenopril; Pharmacology (medical)MedicineHumansPharmacology (medical)Myocardial infarctioneducationRandomized Controlled Trials as Topiceducation.field_of_studyLeft ventricular dysfunctionEjection fractionbusiness.industryGeneral Medicinemedicine.diseaseZofenopril030104 developmental biologyTreatment OutcomechemistryAngiotensin-converting enzyme inhibitorHeart failureCardiologyNumber needed to treatbusinessmedicine.drug
researchProduct

Zofenopril is a cost-effective treatment for patients with left ventricular systolic dysfunction following acute myocardial infarction: a pharmacoeco…

2013

Objective: The Survival of Myocardial Infarction Long-term Evaluation 4 Study (SMILE-4) showed the superiority of Zofenopril (Z) associated with Acetylsalicylic Acid (ASA) as respect to Ramipril (R) plus ASA in reducing the occurrence of major cardiovascular events, in patients with left ventricular dysfunction (LVD) following Acute Myocardial Infarction (AMI). The objective of this retrospective analysis was the evaluation of cost-effectiveness of Z compared to R. Methods: 771 patients with LVD and AMI were randomized, double-blind to Z 60 mg/day (n=389) or R 10 mg/day (n=382) plus ASA 100 mg/day and followed-up for 1 year. The primary study end-point was 1-year combined occurrence of deat…

RamiprilPediatricsmedicine.medical_specialtyeducation.field_of_studybusiness.industryCost effectivenessSurrogate endpointPopulationmedicine.diseaseConfidence intervalZofenoprilchemistry.chemical_compoundchemistryInternal medicinemedicineCardiologyNumber needed to treatMyocardial infarctionCardiology and Cardiovascular Medicinebusinesseducationhealth care economics and organizationsmedicine.drugEuropean Heart Journal
researchProduct

Zofenopril and Ramipril in Combination with Acetyl Salicylic Acid in Postmyocardial Infarction Patients with Left Ventricular Systolic Dysfunction: A…

2016

Summary Objective In the SMILE-4 study, zofenopril + acetyl salicylic acid (ASA) was more effective than ramipril + ASA on 1-year prevention of major cardiovascular events (MACE) in patients with acute myocardial infarction complicated by left ventricular dysfunction. In this retrospective analysis, we evaluated drug efficacy in subgroups of patients, according to a history of diabetes mellitus. Methods The primary study endpoint was 1-year combined occurrence of death or hospitalization for cardiovascular causes. Diabetes was defined according to medical history (previous known diagnosis). Results A total of 562 of 693 (81.0%) patients were classified as nondiabetics and 131 (18.9%) as dia…

MaleCaptoprilDiabetic CardiomyopathiesMyocardial InfarctionInfarctionAngiotensin-Converting Enzyme Inhibitors030204 cardiovascular system & hematologychemistry.chemical_compoundVentricular Dysfunction Left0302 clinical medicineDiabetes mellitusRamiprilRetrospective StudieCardiovascular DiseaseMedicinePharmacology (medical)030212 general & internal medicineMyocardial infarctionDiabetic CardiomyopathieRandomized Controlled Trials as TopicAspirinLeft ventricular dysfunctionGeneral MedicineAcetyl salicylic acid; Acute myocardial infarction; Angiotensin-converting enzyme inhibitors; Diabetes mellitus; Left ventricular dysfunction; Ramipril; Zofenopril; Cardiology and Cardiovascular Medicine; Pharmacology (medical); PharmacologyMiddle AgedZofenoprilAcetyl salicylic acidCardiovascular DiseasesCardiologyPlatelet aggregation inhibitorDrug Therapy CombinationFemaleCardiology and Cardiovascular Medicinemedicine.drugHumanRamiprilmedicine.medical_specialtyDiabetes mellituSystoleAcute myocardial infarctionZofenopril03 medical and health sciencesDiabetes mellitusInternal medicineHumansAgedRetrospective StudiesPharmacologyAspirinbusiness.industryPlatelet Aggregation InhibitorAngiotensin-Converting Enzyme Inhibitormedicine.diseasechemistryAngiotensin-converting enzyme inhibitorbusinessMacePlatelet Aggregation Inhibitors
researchProduct

Zofenopril and ramipril in patients with left ventricular systolic dysfunction after acute myocardial infarction: A propensity analysis of the Surviv…

2016

Introduction: This was a propensity score analysis of the prospective, randomized, double-blind Survival of Myocardial Infarction Long-term Evaluation (SMILE) 4 study in which one-year treatment with zofenopril 60 mg plus acetylsalicylic acid (ASA) 100 mg gave superior results compared to ramipril 10 mg plus ASA in terms of death or hospitalization for cardiovascular causes in patients with acute myocardial infarction (AMI) complicated by left ventricular dysfunction (LVD). Materials and methods: A total of 716 patients of the intention-to-treat population were divided into homogeneous propensity quintiles (Q) using a logistic regression model (QI: best risk profile; QV: worst risk profile)…

MaleMedicine (General)Time FactorsCaptoprilIntention to Treat AnalysiLeftMyocardial Infarction030204 cardiovascular system & hematologychemistry.chemical_compoundVentricular Dysfunction Left0302 clinical medicineEndocrinologyRamiprilPropensity analysisAcetylsalicylic acid; Acute myocardial infarction; Angiotensin-converting enzyme inhibitors; Left ventricular dysfunction; Propensity analysis; Captopril; Demography; Drug Therapy Combination; Endpoint Determination; Female; Hospitalization; Humans; Intention to Treat Analysis; Male; Middle Aged; Myocardial Infarction; Ramipril; Survival Analysis; Time Factors; Ventricular Dysfunction Left; Propensity Score; Internal Medicine; EndocrinologyVentricular DysfunctionMedicine030212 general & internal medicineMyocardial infarctioneducation.field_of_studyLeft ventricular dysfunctionElectrocardiography in myocardial infarctionMiddle AgedZofenoprilIntention to Treat AnalysisHospitalizationCombinationCardiologyOriginal ArticleDrug Therapy CombinationFemaleSurvival AnalysiPropensity analysimedicine.drugHumanRamiprilmedicine.medical_specialtyTime FactorEndpoint DeterminationPopulationAcute myocardial infarction03 medical and health sciencesR5-920Drug TherapyInternal medicineAngiotensin-converting enzyme inhibitorsAcetylsalicylic acidInternal MedicineHumanseducationPropensity ScoreDemographybusiness.industryOdds ratiomedicine.diseaseSurvival AnalysisConfidence intervalchemistryAngiotensin-converting enzyme inhibitorPropensity score matchingbusiness
researchProduct

Comparison between zofenopril and ramipril in combination with acetylsalicylic acid in patients with left ventricular systolic dysfunction after acut…

2012

Background: Angiotensin-converting enzyme inhibitors (ACEIs) are largely employed for treating patients with left ventricular dysfunction (LVD), but their efficacy may be negatively affected by concomitant administration of acetylsalicylic acid (ASA), with some difference among the different compounds. Hypothesis: The interaction between ASA and the two ACEIs zofenopril and ramipril may result in a different impact on survival of cardiac patients, due to differences in the pharmacological properties of the two ACEIs. Methods: This phase IIIb, randomized, double-blind, parallel-group, multicenter, European study compared the safety and efficacy of zofenopril (60 mg/day) and ramipril (10 mg/d…

MaleCaptoprilTime FactorsMyocardial InfarctionAngiotensin-Converting Enzyme InhibitorsKaplan-Meier EstimateVentricular Function Leftlaw.inventionchemistry.chemical_compoundVentricular Dysfunction LeftRandomized controlled trialRamiprillawRisk FactorsOdds RatioMyocardial infarctionProspective Studieseducation.field_of_studyEjection fractionGeneral MedicineMiddle AgedZofenoprilEuropeHospitalizationTreatment OutcomeCardiologyDrug Therapy CombinationFemaleCardiology and Cardiovascular Medicinemedicine.drugRamiprilmedicine.medical_specialtySystolePopulationClinical InvestigationsRisk AssessmentDouble-Blind MethodInternal medicinemedicineHumanseducationAgedHeart FailureChi-Square DistributionAspirinbusiness.industryStroke Volumeacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareSurgeryLogistic ModelschemistryAngiotensin-converting enzyme inhibitorHeart failureMyocardial infarction complicationsZofenopril ramipril myocardial infarctionbusinessPlatelet Aggregation Inhibitors
researchProduct

Methods to investigate coronary microvascular function in clinical practice.

2012

A growing amount of data is increasingly showing the relevance of coronary microvascular dysfunction (CMVD) in several clinical contexts. This article reviews techniques and clinical investigations of the main noninvasive and invasive methods proposed to study coronary microcirculation and to identify CMVD in the presence of normal coronary arteries, also trying to provide indications for their application in clinical practice.

Diagnostic Imagingmedicine.medical_specialtymyocardial contrast echocardiographyCoronary microcirculationCoronary Artery DiseaseCoronary microvascular functionDiagnostic toolsintracoronary Doppler ultrasoundMicrocirculationcoronary microcirculationtransthoracic Doppler echocardiographyCoronary artery diseaseCoronary circulationcardiovascular magnetic resonanceInternal medicineCoronary CirculationmedicineDIAGNOSTIC TOOLSHumansNormal coronary arteriesbusiness.industryMicrocirculationGeneral Medicinemedicine.diseaseSettore MED/11 - Malattie Dell'Apparato Cardiovascolarediagnostic investigationClinical PracticeMyocardial contrast echocardiographymedicine.anatomical_structurePETcardiovascular magnetic resonance; coronary microcirculation; diagnostic investigation; intracoronary Doppler ultrasound; myocardial contrast echocardiography; PET; transthoracic Doppler echocardiography; Coronary Artery Disease; Coronary Circulation; Diagnostic Imaging; Humans; Microcirculation; Cardiology and Cardiovascular MedicineSettore MED/11 - MALATTIE DELL'APPARATO CARDIOVASCOLARECardiologymicrovascular functionHEARTCORONARYbusinessCardiology and Cardiovascular Medicine
researchProduct