0000000000470293

AUTHOR

Peter Jones

showing 43 related works from this author

Alpha-decay studies of the francium isotopes 198Fr and 199Fr nuclei

2013

Very neutron deficient francium isotopes have been produced in fusion evaporation reactions using 60Ni ions on 141Pr targets. The gas-filled recoil separator RITU was employed to collect the fusion products and to separate them from the scattered beam. The activities were implanted into a position sensitive silicon detector after passing through a gas-counter system. The isotopes were identified using spatial and time correlations between the implants and the decays. Two α-particle activities, with Eα = 7613(15) keV and T1/2 = (15+12 −5 ) ms and Eα = 7684(15) keV and T1/2 = (16+13 −5 ) ms were identified in the new isotope 198Fr. In addition, the half-life and α-particle energy of 199Fr wer…

Experimental Nuclear Physics
researchProduct

Recoil isomer tagging in the proton-rich odd-odd N = 77 isotones, 142Tb and 144Ho

2001

A fusion-evaporation reaction has been employed to search for isomeric states in the near-proton drip-line N577 isotones, 65 142Tb and 67 144Ho. The recoiling nuclei were implanted into a silicon detector at the focal plane of a gas-filled separator, where a recoil isomer tagging technique was employed to correlate prompt and delayed g-ray transitions across isomeric states. New states were observed to be built upon a known 15-ms isomer in 142Tb and the feeding and decay of a new 500(20)-ns isomeric state was established in 144Ho. This measurement represents the first observation of excited states in 144Ho. The behavior of the new states above the isomers suggests that they are built upon l…

Nuclear TheoryPhysics::Atomic and Molecular ClustersisomerstaggingNuclear Experiment
researchProduct

High-spin spectroscopy of 140Nd

2013

The population of the high-spin states in 140Nd was investigated using the reaction 96Zr(48Ca,4n). The results from two experiments, one with the EUROBALL array and one with the JUROGAM II + RITU + GREAT setup employing the recoil decay tagging technique, have been combined to develop a very detailed level scheme for 140Nd. Twelve bands of quadrupole transitions and eleven bands of dipole transitions were identified and their connections to low-lying states were established. Calculations using the cranked Nilsson-Strutinsky and the tilted axis cranking models were used to interpret the observed structures. The overall good agreement between the experimental results and the calculations assu…

Nuclear TheoryExperimental Nuclear Physics
researchProduct

Electromagnetic transition strengths in 109Te

2012

Lifetime measurements have been made in the neutron-deficient nucleus 109Te using the coincident recoil distance Doppler-shift method. The experimental B(E2) values have been compared with state-of-the-art shellmodel calculations using the monopole-corrected realistic charge-dependent Bonn nucleon-nucleon potential. Lifetimes in the νh11/2 band are consistent with an interpretation based on the deformation driving properties of a single valence neutron outside of the even-even tellurium core and highlight the unexpected presence of collective behavior as the N = 50 shell closure is approached. Lifetime measurements for the low-lying positive-parity states also appear to correlate well with …

Nuclear TheoryExperimental nuclear physicsNuclear ExperimentKokeellinen ydinfysiikka
researchProduct

Spectroscopy of the proton drip-line nucleus 203Fr

2013

The nucleus 203Fr has been studied through γ -ray and electron spectroscopy, using the recoil-decay tagging technique. A 13/2+ state, with a half-life of 0.37(5) μs, has been observed in 203Fr. Both the α-decay branch and the internal de-excitation of the 1/2+ isomer in 203Fr have been studied. Furthermore, the corresponding 1/2+ state, with a half-life of 0.31(8) s, has been found in 199At. In addition, transitions feeding the 9/2− ground state of 203Fr have been identified. The observed level pattern suggests that the ground state is still spherical. peerReviewed

Experimental Nuclear Physics
researchProduct

Octupole correlations in the structure of 0$_2^+$ bands in the N=88 nuclei 150Sm and 152Gd

2013

Knowledge of the exact microscopic structure of the 01 + ground state and first excited 02 + state in 150Sm is required to understand the branching of double β decay to these states from 150Nd. The detailed spectroscopy of 150Sm and 152Gd has been studied using (α,xn) reactions and the γ -ray arrays AFRODITE and JUROGAM II. Consistently strong E1 transitions are observed between the excited Kπ = 02 + bands and the lowest negative parity bands in both nuclei. These results are discussed in terms of the possible permanent octupole deformation in the first excited Kπ = 02 + band and also in terms of the “tidal wave” model of Frauendorf. peerReviewed

Experimental Nuclear Physics
researchProduct

Reduced transition probabilities along the yrast line in 166W

2017

Lifetimes of excited states in the yrast band of the neutron-deficient nuclide 166W have been measured utilizing the DPUNS plunger device at the target position of the JUROGAM II γ -ray spectrometer in conjunction with the RITU gas-filled separator and the GREAT focal-plane spectrometer. Excited states in 166W were populated in the 92Mo(78Kr,4p) reaction at a bombarding energy of 380 MeV. The measurements reveal a low value for the ratio of reduced transitions probabilities for the lowest-lying transitions B(E2; 4+ → 2+)/B(E2; 2+ → 0+) = 0.33(5), compared with the expected ratio for an axially deformed rotor (B4/2 = 1.43). peerReviewed

nuclear physicsydinfysiikka
researchProduct

Experimental investigation of the 0⁺₂ band in ¹⁵⁴Sm as a β-vibrational band

2014

gamma rayspektroskopiarare-earthcollective modelselectric monopoleinternal conversion electrons
researchProduct

First prompt in-beam gamma-ray spectroscopy of a superheavy element: the 256Rf

2013

Using state-of-the-art γ-ray spectroscopic techniques, the first rotational band of a superheavy element, extending up to a spin of 20 ¯h, was discovered in the nucleus 256Rf. To perform such an experiment at the limits of the present instrumentation, several developments were needed. The most important of these developments was of an intense isotopically enriched 50Ti beam using the MIVOC method. The experimental set-up and subsequent analysis allowed the 256Rf ground-state band to be revealed. The rotational properties of the band are discussed and compared with neighboring transfermium nuclei through the study of their moments of inertia. These data suggest that there is no evidence of a…

Experimental Nuclear Physics
researchProduct

International Society for Therapeutic Ultrasound Conference 2016

2017

Meeting AbstractsJournal of Therapeutic Ultrasound
researchProduct

Development of a new Recoil Distance Technique using Coulomb Excitation in Inverse Kinematics

2009

We report on an experiment using Coulomb excitation in inverse kinematics in combination with the plunger technique for measuring lifetimes of excited states of the projectiles. Aside from the investigation of E(5) features in 128Xe, the aim was to explore the special features of such experiments which are also suited to be used with radioactive beams. The measurement was performed at the JYFL with the Koln coincidence plunger device and the JUROGAM spectrometer using a 128Xe beam impinging on a natFe target at a beam energy of 525 MeV. Recoils were detected by means of 32 solar cells placed at extreme forward angles. Particle‐gated γ‐singles and γγ‐coincidences were measured at different t…

Nuclear physicsPlungerPhysicsRecoilSpectrometerInverse kinematicsExcited stateCoulomb excitationKinematicsBeam (structure)AIP Conference Proceedings
researchProduct

Studying the double-frequency heating mode in ECRIS plasma using Kα diagnostics

2018

Despite the success of double-heating frequency in enhancing high charge state production, the underlying physics remains poorly understood. By combining three different diagnostic techniques i.e. Kα emission, optical emission and the extracted charge state distribution, it is now possible to assess the proposed explanations for the effectiveness of double-frequency heating against the experimental results. These results seem to indicate that the increase of plasma density accounts largely for the favorable behavior of this operation mode compared to single-frequency mode. peerReviewed

double-heating frequencyMaterials scienceta114syklotronitemissionMode (statistics)PlasmaAtomic physicsDouble frequencyplasmafysiikkaplasmaplasma (kaasut)emissio (fysiikka)
researchProduct

Genome-wide Association Analysis in Humans Links Nucleotide Metabolism to Leukocyte Telomere Length

2020

Leukocyte telomere length (LTL) is a heritable biomarker of genomic aging. In this study, we perform a genome-wide meta-analysis of LTL by pooling densely genotyped and imputed association results across large-scale European-descent studies including up to 78,592 individuals. We identify 49 genomic regions at a false dicovery rate (FDR) < 0.05 threshold and prioritize genes at 31, with five highlighting nucleotide metabolism as an important regulator of LTL. We report six genome-wide significant loci in or near SENP7, MOB1B, CARMIL1, PRRC2A, TERF2, and RFWD3, and our results support recently identified PARP1, POT1, ATM, and MPHOSPH6 loci. Phenome-wide analyses in >350,000 UK Biobank p…

Netherlands Twin Register (NTR)LimfomesLOCIGenome-wide association studyDiseaseVARIANTSDISEASE0302 clinical medicineLeukocytestelomere lengthGWASGenetics(clinical)CàncerMendelian randomisationThyroid cancerGenetics (clinical)11 Medical and Health SciencesCancerGeneticsGenetics & HeredityRISK0303 health sciencesTelòmerage-related disease; biological aging; Mendelian randomisation; telomere length; Humans; Leukocytes; Nucleotides; Genome-Wide Association Study; TelomereNucleotidesmeta-analyysigenomiikkaGenomicsTelomereCANCER3. Good health030220 oncology & carcinogenesisbiological agingMENDELIAN RANDOMIZATION/dk/atira/pure/sustainabledevelopmentgoals/good_health_and_well_beingMedical geneticsBiomarker (medicine)HEARTLymphomasLife Sciences & BiomedicineMedical Geneticsmedicine.medical_specialtyGENESDATABASEAge-related Disease ; Biological Aging ; Mendelian Randomisation ; Telomere LengthBiologyArticle03 medical and health sciencesSDG 3 - Good Health and Well-beingMendelian randomization/dk/atira/pure/keywords/cohort_studies/netherlands_twin_register_ntr_medicineGeneticsJournal ArticleHumans030304 developmental biologyMedicinsk genetikage-related diseaseScience & TechnologyCancer06 Biological Sciencesmedicine.diseaseTelomereGenòmicaikääntyminen1182 Biochemistry cell and molecular biologytelomeeritbiologicalGenome-Wide Association Study
researchProduct

Towards higher sensitivity at the RITU focal plane

2001

The recently reconstructed focal plane detector system for the gas-filled recoil separator RITU was used to observe a new proton emitter 164Ir. The nuclide was produced via the p5n fusion evaporation channel using a 64Zn beam on a 106Cd target. The proton energy Ep = 1817(9) keV and half-life T1/2 = 113+62-30 μ s were used to characterize the decaying state to be [π h11/2 ν f7/2]9+. The new focal plane detector system and the results of the proton decay studies will be discussed. peerReviewed

focal planesNuclear Experimentdetector systems
researchProduct

Alpha decay studies of translead nuclei at the proton drip line

2001

Extensive α-decay studies of the very neutron deficient isotopes 191Po, 195Rn, and 196Rn have been performed at the RITU gas-filled recoil separator. The recoil-α–(α) correlation technique and the α–γ coincidence technique have been utilized to unambiguously connect the observed α-decays to proper nuclei. Illustrative examples on how the α-decay can yield spectroscopic information on the nuclei studied will be presented. peerReviewed

fysiikkaNuclear Experiment
researchProduct

Studies of 225,226U alpha decay chains

2001

Studies of 225,226U α -decay chains produced via heavy ion induced fusion reactions of 22Ne + 208Pb → 230U and of 18O + 208Pb → 226Th were carried out using the JYFL gas-filled magnetic recoil separator RITU. The data obtained for α -decays of 225,226U, 221,222Th, 218Ra and 213Rn concerning their α -particle energies, half-lives and α -decay fine structures are compared to previous investigations. peerReviewed

alpha decay chains
researchProduct

Investigation into the gas mixing effect in ECRIS plasma using Kα and optical diagnostics

2018

Mixing a lighter gas species into the plasma of an ECRIS is known to enhance high charge state production of the heavier gas species. With this investigation, Kα diagnostics, optical emission spectroscopy and the measured charge state distribution of the extracted beam were combined to shed more light on the physics governing this phenomenon. Kα diagnostics data from two ion sources, the JYFL 14 GHz ECRIS and the GTS at iThemba LABS, are presented to gain confidence on the observed trends. The results seem to favor ion cooling as the most likely mechanism responsible for the favorable influence of the gas mixing.Mixing a lighter gas species into the plasma of an ECRIS is known to enhance hi…

Materials scienceta114ionitsyklotronitPlasmaplasmafysiikkaGas mixingIonNuclear physicsOptical diagnosticsIon coolingionsOptical emission spectroscopycyclotron resonanceState distributionplasmaplasma (kaasut)Beam (structure)AIP Conference Proceedings
researchProduct

Clarification of the Three-Body Decay of 12C (12.71 MeV)

1991

Using β decays of a clean source of 12 N produced at the IGISOL facility, we have measured the breakup of the 12 C (12.71 MeV) state into three α particles with a segmented particle detector setup. The high quality of the data permits solving the question of the breakup mechanism of the 12.71 MeV state, a longstanding problem in few-body nuclear physics. Among existing models, a modified sequential model fits the data best, but systematic deviations indicate that a three-body description is needed. peerReviewed

nuclear physicsNuclear Physics - Experimentydinfysiikka
researchProduct

Prompt and delayed spectroscopy of 199At

2010

The neutron-deficient nucleus At199 has been studied through γ-ray and electron spectroscopy, using the recoil-decay tagging technique. Two experiments were conducted, using a gas-filled recoil separator with a focal-plane spectrometer alone and together with a germanium-detector array at the target position. The resulting level scheme for At199 includes a new isomer with a half-life of 0.80(5) μs and a spin and parity of (29/2+). The 13/2+ isomer, which de-excites via an M2 transition to the 9/2− ground state, was measured to have a half-life of 70(20) ns. Our earlier version of the level scheme for At197 has been updated as well. peerReviewed

nuclear spectroscopyydinrakenneaccelerator-based physicsnuclear structureydinspektroskopiaydinfysiikkakiihdytinpohjainen fysiikka
researchProduct

Search for the terminating 27- state in 140Nd

2015

In the search for the fully aligned 27− state in 140Nd predicted by cranked Nilsson-Strutinsky calculations, new close-to-spherical high-spin states have been discovered. Both the close-to-spherical and the triaxial calculated states are in good agreement with the experimental results, supporting the existence of shape coexistence up to very high spins. Shell-model calculations using a newly developed effective interaction for the 50 N ,Z 82 mass region are in good agreement with the observed spherical states. The comparison between the experimental and calculated level energies allowed the relative energy to be established between several proton and neutron orbitals at high energy and spin…

nuclear spinNuclear Theoryneodyymi
researchProduct

Spectroscopy of transfermium nuclei: No-252(102)

2001

An in-beam study of excited states in the transfermium nucleus 252 No has been performed using the recoil separator RITU together with the JUROSPHERE II array at the University of Jyväskylä. This is the second transfermium nucleus studied in an in-beam experiment. Levels up to spin 20 were populated and compared to levels in 254 No . An upbend is seen at a frequency of 200 keV/ħ corresponding to spin 16. We also use an improved systematics to connect the energy of the lowest 2 + state with its half-life and find that the deformation of both 2 5 2 , 2 5 4 No is slightly larger than previously assumed. peerReviewed

spectroscopyspektroskopia
researchProduct

Quasiparticle alignments and α-decay fine structure of 175Pt

2014

Excited states and decay properties of 175Pt have been investigated using the 92Mo(86Sr,2pn) fusion-evaporation reaction. The JUROGAM I γ -ray spectrometer and the GREAT spectrometer were used in conjunction with the gas-filled recoil separator RITU for the measurement of the radiation at the target and focal plane positions, respectively. Two new band structures, assigned to be based on the I π = (7/2 −) ground state in 175Pt, have been established and the known yrast band has been extended up to I π = (49/2 +). Rotational properties of the excited states in 175Pt have been investigated within the cranked shell-model formalism. The low-frequency changes in the alignments of the positive- a…

Nuclear Experimentquasiparticle alignmentsdeficient platinum isotopesnuclear-data sheets
researchProduct

Competing Decay Modes of a High-spin Isomer in the Proton-unbound Nucleus 158Ta

2015

An isomeric state at high spin and excitation energy was recently observed in the proton-unbound nucleus 158Ta. This state was observed to decay by both α and γ decay modes. The large spin change required to decay via γ-ray emission incurs a lifetime long enough for α decay to compete. The α decay has an energy of 8644(11) keV, which is among the highest observed in the region, a partial half-life of 440(70) µs and changes the spin by 11~. In this paper, additional evidence supporting the assignment of this α decay to the high-spin isomer in 158Ta will be presented. peerReviewed

tantaaliisomeric statesHigh Energy Physics::Experiment
researchProduct

Transition probability studies in 175Au

2013

Transition probabilities have been measured between the low-lying yrast states in 175Au by employing the recoil distance Doppler-shift method combined with the selective recoil-decay tagging technique. Reduced transition probabilities and magnitudes of transition quadrupole moments have been extracted from measured lifetimes allowing dramatic changes in nuclear structure within a low excitation-energy range to probed. The transition quadrupole moment data are discussed in terms of available systematics as a function of atomic number and aligned angular momentum. peerReviewed

Physics::Atomic PhysicsExperimental Nuclear Physics
researchProduct

Multiparticle configurations of excited states in 155Lu

2016

Excited states in the neutron-deficient N=84 nuclide 155Lu have been populated by using the 102Pd(58Ni,αp) reaction. The 155Lu nuclei were separated by using the gas-filled recoil ion transport unit (RITU) separator and implanted into the Si detectors of the gamma recoil electron alpha tagging (GREAT) spectrometer. Prompt γ-ray emissions measured at the target position using the JUROGAM Ge detector array were assigned to 155Lu through correlations with α decays measured in GREAT. Structures feeding the (11/2−) and (25/2−)α-decaying states have been revised and extended. Shell-model calculations have been performed and are found to reproduce the excitation energies of several of the low-lyin…

lutetiumneutron-deficient nucleiNuclear Experimentexcited states
researchProduct

Probing the shape of 176Hg along the yrast line

1998

In-beam γ-ray and γ-γ coincidence measurements have been made for the very neutron-deficient nucleus 176Hg using the recoil-decay tagging (RDT) technique. The irregular yrast sequence observed up to I=10ħ indicates that the prolate intruder band, seen in heavier Hg isotopes near the neutron midshell, crosses the nearly spherical ground-state band of 176Hg above I=6ħ. peerReviewed

isotoopitNuclear TheoryneutronitfysiikkaNuclear Experimentydinfysiikka
researchProduct

Level structure above the 17+ isomeric state in 152 69 Tm83

2018

Excited states above the 17+ isomeric state in the proton-rich nucleus 152Tm were established by employing the recoil-isomer tagging technique. Data were collected using the JUROGAM gamma-ray array and the GREAT spectrometer together with the recoil ion transport unit (RITU) gas-filled recoil separator and analyzed to identify the prompt and delayed γ decays from the levels in 152Tm. Shell-model calculations, either in a large valence space or in a reduced model space with five protons in the π0h11/2 orbital and one neutron in the ν1f7/2 orbital, agree with the observed energies of the yrast levels up to angular momentum J = 21. The observation of near degeneracies in the energy spectrum ca…

lifetimes and widthselectromagnetic transitionsNuclear Theorynuclear spin and parityshell modelnuclear forcesNuclear Experimentisomer decaysydinfysiikka
researchProduct

Excited states and reduced transition probabilities in Os 168

2016

The level scheme of the neutron-deficient nuclide 168Os has been extended and mean lifetimes of excited states have been measured by the recoil distance Doppler-shift method using the JUROGAM γ -ray spectrometer in conjunction with the IKP Koln plunger device. The ¨ 168Os γ rays were measured in delayed coincidence with recoiling fusion-evaporation residues detected at the focal plane of the RITU gas-filled separator. The ratio of reduced transition probabilities B(E2; 4+ 1 → 2+ 1 )/B(E2; 2+ 1 → 0+ 1 ) is measured to be 0.34(18), which is very unusual for collective band structures and cannot be reproduced by interacting boson model (IBM-2) calculations based on the SkM* energy-density func…

excited states
researchProduct

α decay of the πh11/2 isomer in Ir164

2014

The α -decay branch of the πh 11 / 2 isomer in 164 Ir has been identified using the GREAT spectrometer. The 164 Ir nuclei were produced using the 92 Mo( 78 Kr ,p 5 n ) 164 Ir reaction and separated in flight using the recoil ion transport unit (RITU) gas-filled separator. The measured α -decay energy of 6880 ± 10 keV allowed the excitation of the πh 11 / 2 state in 160 Re to be deduced as 166 ± 14 keV. The half-life of 164 Ir was measured with improved precision to be 70 ± 10 μ sandan α -decay branching ratio of 4 ± 2% was determined. Improved half-life and branching ratio measurements were also obtained for 165 Ir, but no evidence was found for the ground-state decays of either 164 Ir or 1…

neutron-deficent isotopesenergianuclear-structuremodeltotal data readout. proton drip-lineemissionrituosmiumvolframi
researchProduct

5th International Symposium on Focused Ultrasound

2016

Introduction Breast fibroadenomata (FAD) are benign lesions which occur in about 10 % of all women. Diagnosis is made by triple assessment (physical examination, imaging and/or histopathology/cytology). For a definitive diagnosis of FAD, the treatment is conservative unless the patient is symptomatic. For symptomatic patients, the lumps can be surgically excised or removed interventionally by vacuum-assisted mammotomy (VAM). Ablative techniques like high-intensity focused ultrasound (HIFU), cryo-ablation and laser ablation have also been used for the treatment of FAD, providing a minimally invasive treatment without scarring or poor cosmesis. This review summarises current trials using mini…

lcsh:Medical physics. Medical radiology. Nuclear medicineFibroadenomataCryo-ablationHigh-intensity focused ultrasoundAblative techniqueslcsh:R895-920ReviewMeeting AbstractsLaser ablationJournal of Therapeutic Ultrasound
researchProduct

Excited states in the proton-unbound nuclide 158Ta

2016

Excited states in the neutron-deficient odd-odd proton-unbound nuclide 158Ta have been investigated in two separate experiments. In the first experiment, 166Ir nuclei were produced in the reactions of 380 MeV 78Kr ions with an isotopically enriched 92Mo target. The α-decay chain of the 9+ state in 166Ir was analyzed. Fine structure in the α decay of the 9+ state in 162Re established a 66 keV difference in excitation energy between the lowest-lying 9+ and 10+ states in 158Ta. Higher-lying states in 158Ta were populated in the reactions of 255 MeV 58Ni ions with an isotopically enriched 102Pd target. Gamma-ray decay paths that populate, depopulate, and bypass a 19− isomeric state have been id…

tantaaliNuclear Experimentexcited states
researchProduct

Alpha-decay studies of the nuclides 195Rn and 196Rn

2001

The new neutron deficient nuclide 195 Rn and the nuclide 196 Rn have been produced in fusion evaporation reactions using 56 Fe ions on 142 Nd targets. A gas-filled recoil separator was used to separate the fusion products from the scattered beam. The activities were implanted in a position sensitive silicon detector. The isotopes were identified using spatial and time correlations between implants and decays. Two α decaying isomeric states, with E α = 7536 ( 11 ) keV [ T 1 / 2 = ( 6 + 3 − 2 ) ms ] for the ground state and E α = 7555 ( 11 ) keV [ T 1 / 2 = ( 5 + 3 − 2 ) ms ] for an isomeric state were identified in 195 Rn . In addition, the half-life and α decay energy of 196 Rn were measure…

nukliditdecay studies
researchProduct

High-spin states beyond the proton drip-line: Quasiparticle alignments in Cs-113

2015

Excited states have been studied in the deformed proton emitter 113Cs. Gamma-ray transitions have been unambiguously assigned to 113Cs by correlation with its characteristic proton decay, using the method of recoil-decay tagging. Two previously identified rotational bands have been observed and extended to tentative spins of 45/2 and 51/2 h¯, with excitation energies over 8 MeV above the lowest state. These are the highest angular momenta and excitation energies observed to date in any nucleus beyond the proton drip-line. Transitions in the bands have been rearranged compared to previous work. A study of aligned angular momenta, in comparison to the predictions of Woods–Saxon cranking calcu…

proton decayhigh-spin statesNuclear Theoryrecoil decay taggingNuclear Experimentquasiparticle alignmentsgamma ray spectroscopy
researchProduct

Detailed spectroscopy of 193Bi

2015

An experiment aiming to study shape coexistence in 193Bi has been performed. Due to its transitional character, it has an exceptionally large number of structures identified close to the yrast line. Many new states have been found, significantly extending the previously known level scheme of 193Bi, including several new rotational bands. The π i13/2 band was extended to I π = 45/2+. The I π = 31/2+ member of the π i13/2 band was found to de-excite also to a long-lived isomeric state. This isomeric state is located at 2350 keV and has a spin and parity of 29/2+. The half-life of the isomeric state was measured to be 85(3) μs and it decays via the emission of an 84 keV E2 transition. A level …

nuclear spectroscopyvismutti
researchProduct

Spectroscopy of 193Bi

2014

spektroskopiashape coexistence
researchProduct

Gamma-ray and decay spectroscopy of 194,195,196At

2013

Excited states of 195At have been studied by means of in-beam γ -ray spectroscopy and the recoil-decay tagging technique. A strongly coupled rotational band feeding the α-decaying 7/2− state via unobserved transitions was identified. This band is presumably built on the oblate proton I π = 13/2+ state. Confirming earlier measurements, α decays from the 1/2+ and 7/2− states were observed. Additionally, an E3 branch competing with the α decay of the 7/2− state was inferred. Also α decays of the odd-odd isotopes 194,196At were examined. peerReviewed

High Energy Physics::ExperimentExperimental Nuclear Physics
researchProduct

Recoil-beta tagging study of the N=Z nucleus 66As

2013

An in-beam study has been performed to further investigate the known isomeric decays and to identify T = 1 excited states in the medium-heavy N = Z = 33 nucleus 66As. The fusion-evaporation reaction 40Ca(28Si,pn) 66As was employed at beam energies of 75 and 83 MeV. The half-lives and ordering of two known isomeric states in 66As have been determined with improved accuracy. In addition, several prompt γ -ray transitions from excited states, both bypassing and decaying to the isomeric states in 66As, have been observed. Most importantly, candidates for the 4+ → 2+ and 6+ → 4+ transitions in the T = 1 band have been identified. The results are compared with shell-model calculations using the m…

Experimental Nuclear Physics
researchProduct

First observation of excited states of 173Hg

2012

The neutron-deficient nucleus 173Hg has been studied following fusion-evaporation reactions. The observation of the decay of excited states via γ radiation are reported for the first time and a tentative level scheme is proposed. The proposed level scheme is discussed within the context of the systematics of neighboring neutron-deficient Hg nuclei. In addition to the γ -ray spectroscopy, the α decay of this nucleus has been measured yielding superior precision to earlier measurements. peerReviewed

Nuclear TheoryExperimental nuclear physicsNuclear ExperimentKokeellinen ydinfysiikka
researchProduct

Underground multi-muon experiment EMMA

2011

EMMA is a new experiment designed for cosmic-ray composition studies around the knee energy operating at the shallow depth underground in the Pyhäsalmi mine, Finland. The array has sufficient coverage and resolution to determine the multiplicity, the lateral density distribution and the arrival direction of high-energy muons on an event by event basis. Preliminary results on the muon multiplicity extracted using one detector station of the array are presented. peerReviewed

nuclear spectroscopyPhysics::Instrumentation and Detectorsaccelerator-based physicsmaanalainen fysiikkamyonitKosmiset säteetkiihdytinpohjainen fysiikkaastrohiukkasfysiikkaydinrakennenuclear structureydinspektroskopiaHigh Energy Physics::Experimentpolviydinfysiikka
researchProduct

Candidatus Phytoplasma, a taxon for the well-less, non-helical prokaryotes that colonize plant phloem and insects

2004

International audience

[SDV] Life Sciences [q-bio][SDV]Life Sciences [q-bio]ComputingMilieux_MISCELLANEOUS
researchProduct

Low-lying excited states in the neutron-deficient isotopes 163Os and 165Os

2013

Excited states in the neutron-deficient isotopes 163Os and 165Os were identified using the JUROGAM and GREAT spectrometers in conjunction with the RITU gas-filled separator. The 163Os and 165Os nuclei were populated via the 106Cd(60Ni,3n) and 92Mo(78Kr,2p3n) reactions at bombarding energies of 270 MeV and 357 MeV, respectively. Gamma-ray emissions from these nuclei have been established unambiguously using the recoil-decay tagging technique and a coincidence analysis has allowed level schemes to be established. These results suggest that the yrast states are based upon negative-parity configurations originating from the νf7/2 and νh9/2 orbitals. peerReviewed

Nuclear TheoryNuclear ExperimentExperimental Nuclear Physics
researchProduct

Characterizing the atomic mass surface beyond the proton drip line via {\alpha}-decay measurements of the {\pi}s1/2 ground state of 165Re and the {\p…

2012

The α-decay chains originating from the πs1/2 and πh11/2 states in 173Au have been investigated following fusion-evaporation reactions. Four generations of α radioactivities have been correlated with 173Aum leading to a measurement of the α decay of 161Tam. It has been found that the known α decay of 161Ta, which was previously associated with the decay of the ground state, is in fact the decay of an isomeric state. This work also reports on the first observation of prompt γ rays feeding the ground state of 173Au. This prompt γ radiation was used to aid the study of the α-decay chain originating from the πs1/2 state in 173Au. Three generations of α decays have been correlated with this stat…

Experimental nuclear physicsKokeellinen ydinfysiikka
researchProduct

Collective excitations in the transitional nuclei 163Re and 165Re

2015

Excited states in the neutron-deficient nuclei 163 75 Re88 and 165 75 Re90 were populated in the 106Cd(60Ni, p2nγ ) and 92Mo(78Kr, 3p2nγ ) fusion-evaporation reactions at bombarding energies of 270 and 380 MeV, respectively. γ rays were detected at the target position using the JUROGAM spectrometer while recoiling ions were separated in-flight by the RITU gas-filled recoil separator and implanted in the GREAT spectrometer. The energy level schemes for 163Re and 165Re were identified using recoil-decay correlation techniques. At low spin, the yrast bands of these isotopes consist of signature partner bands based on a single πh11/2 quasiproton configuration. The bands display large energy spl…

Nuclear Theoryneutron-deficient nucleirheniumNuclear Experiment
researchProduct