0000000000626292

AUTHOR

Harto Hakonen

showing 34 related works from this author

Motor Competence and Health-related Fitness of School-Age Children: A Two-Year Latent Transition Analysis

2021

PURPOSE The aims of this study were twofold: 1) to identify latent physical performance profiles of motor competence (MC) and cardiorespiratory (CF) and muscular fitness (MF) among school-age children and 2) explore transition probabilities in physical performance profiles over a 2-yr period. METHODS The present sample comprised 1148 (583 girls, 565 boys) elementary school students (baseline Mage = 11.27 ± 0.32), and data were collected annually (equal intervals) over a period of 2 yr which resulted in a total of three measurements. The measures used were the throwing-catching combination test, 5-leaps and two-legged jumps from side-to-side test (MC), 20-meter shuttle run test (CF), and cur…

MaleSchool age childbusiness.industryEarly adolescenceHealth relatedPhysical Therapy Sports Therapy and RehabilitationCardiorespiratory fitnessTest (assessment)Cardiorespiratory FitnessMotor SkillsExercise TestHumansMedicineLatent transition analysisFemaleOrthopedics and Sports MedicineLongitudinal StudiesChildHigh groupbusinessCompetence (human resources)DemographyMedicine & Science in Sports & Exercise
researchProduct

Physical fitness development in relation to changes in body composition and physical activity in adolescence

2020

The decline in adolescents’ physical fitness (PF) in recent decades has raised concerns about current population’s possible future challenges with health and physical functional capacity. This study explored the associations between body composition, physical activity, maturation, and PF development in adolescents. Furthermore, PF development of adolescents with low initial PF was assessed. A 2‐year observational study was conducted between spring 2013 and 2015. Nine comprehensive schools and their 10‐ to 13‐year‐old students were invited to participate in the study (1778), and a total of 971 students (54.6%) agreed. Cardiorespiratory fitness (20‐metre shuttle run), muscular fitness (push‐u…

MalePediatric ObesityTime FactorsPhysical fitnessPsychological intervention030204 cardiovascular system & hematologyliikunta0302 clinical medicinenuoretElectric ImpedanceMedicineOrthopedics and Sports MedicineChildFinlandfundamental movement skillseducation.field_of_studycardiorespiratory fitnessfat massPhysical Functional Performancefat-free massfyysinen kuntomuscular fitnessCardiorespiratory Fitnessfyysinen kehitysBody CompositionFemaleBioelectrical impedance analysisfyysinen aktiivisuusMulti-stage fitness testAdolescentMovementPopulationPhysical Therapy Sports Therapy and Rehabilitationlapset (ikäryhmät)03 medical and health scienceschildrenConfidence IntervalsHumansStudentseducationExercisekehonkoostumusbusiness.industryLatent growth modelingPubertyCardiorespiratory fitness030229 sport sciencesPhysical FitnessObservational studybusinessDemography
researchProduct

Validity and Reliability of a Single Question for Leisure-Time Physical Activity Assessment in Middle-Aged Women.

2020

Purpose: To investigate the validity and test–retest reliability of a single seven-level scale physical activity assessment question (SR-PA L7) and its three-level categorization (SR-PA C3). Methods: The associations of SR-PA L7 and C3 with accelerometer-measured leisure-time physical activity (ACC-LTPA) and with the results of four different physical performance tests (6-min walk [n = 733], knee extension [n = 695], vertical jump [n = 731], and grip force [n = 780]) were investigated among women aged 47–55 years participating in the Estrogenic Regulation of Muscle Apoptosis study (n = 795). The reliability was studied using Spearman correlations with 4-month test–retest period (n = 152). R…

Leisure timePhysical activityValidityPhysical Therapy Sports Therapy and RehabilitationWalkingtestaus03 medical and health sciencesVertical jump0302 clinical medicineLeisure Activitiesphysical activity measurementSurveys and QuestionnairesStatisticstest–retest reliabilityaccelerometryHumans030212 general & internal medicineself-reported physical activityReliability (statistics)MathematicsHand StrengthRehabilitationReproducibility of Results030229 sport sciencesRepeatabilityMiddle AgedPhysical FitnessScale (social sciences)Exercise TestFemaleGeriatrics and GerontologyGrip forceGerontologyhuman activitiesfyysinen aktiivisuusluotettavuusJournal of aging and physical activity
researchProduct

How physical activity, fitness, and motor skills contribute to math performance: Working memory as a mediating factor

2021

Purpose The purpose of this study was to examine whether physical activity, fitness and motor skills have indirect association with math performance via cognitive outcomes and if so, through which aspects of cognition? Methods This study comprised 311 6th–9th grade adolescents (12–17y [M age=14.0y], 59% girls) from seven schools throughout Finland in 2015. Math performance was measured via a teacher-rated math achievement and the Basic Arithmetic test. Cognitive functions were measured by broad cognitive test battery. Physical activity was assessed with a self-reported questionnaire and a hip-worn accelerometer. Aerobic fitness was estimated using a maximal 20-m shuttle run test, muscular f…

kognitiiviset taidotMaleAdolescenteducationPhysical fitnesslapset (ikäryhmät)Physical Therapy Sports Therapy and RehabilitationFitness Trackersliikuntabehavioral disciplines and activitiesworking memoryDevelopmental psychologyCognitionnuoretAcademic PerformanceAccelerometrymental disordersmatemaattiset taidotHumansOrthopedics and Sports MedicineadolescentsCognitive skillmotoriset taidotChildMuscle SkeletalAssociation (psychology)ExerciseFinlandMotor skillmotor skillsWorking memorybusiness.industryCognitiontyömuistiTest (assessment)Cognitive testfyysinen kuntoMemory Short-TermMotor SkillsPhysical Fitnessphysical fitnessExercise TestFemalebusinessfyysinen aktiivisuuspsychological phenomena and processesScandinavian Journal of Medicine & Science in Sports
researchProduct

Objectively Measured School Day Physical Activity Among Elementary Students in the United States and Finland.

2015

Background:Schools are in a unique position to ensure that all students meet the current physical activity (PA) recommendations. This study aimed to examine 1st to 3rd grade elementary students’ accelerometer measured school day PA in the United States (U.S.) and Finland.Methods:The sample consisted of 200 students (107 girls, 93 boys; ages 6 to 8) and their school day PA was monitored with hip-worn ActiGraph GT3X+ accelerometers across a 5-day school week and the thresholds 100 and 2296 count per minute were used to separate sedentary time, light PA, and moderate-to-vigorous PA (MVPA).Results:On an average school day, students were engaged in MVPA for 20.0 min in the U.S. and 24.1 min in F…

Cross-Cultural ComparisonMalemedicine.medical_specialtyTime FactorseducationPhysical activityChild BehaviorMotor ActivityPhysical education03 medical and health sciences0302 clinical medicineschool health promotionMedicineHumansOrthopedics and Sports Medicine030212 general & internal medicineMotor activitySex DistributionChildStudentsExercisePhysical ExaminationFinlandSedentary lifestyleaccelometrySedentary timePhysical Education and TrainingSchoolsbusiness.industry030229 sport sciencesschool healthUnited StatesPhysical therapyFemaleSchool healthSedentary BehaviorbusinessJournal of physical activityhealth
researchProduct

Predicting accelerometer-based physical activity in physical education and total physical activity: The Self-determination Theory approach

2019

The present study tested the motivational model of physical education (PE) including needs for competence, autonomy, social relatedness, intrinsic and extrinsic motivation, in-class moderate to vigorous physical activity (MVPA), and total MVPA. Participants were 490 (264 girls, 226 boys) Finnish elementary school students. The data were collected using accelerometers and questionnaires for a seven-day period during the fall semester 2017. The key findings were that 1) social relatedness associated with total MVPA via in-class MVPA in girls, whereas competence was linked to in-class MVPA through extrinsic motivation in boys, 2) competence was positively linked to extrinsic motivation in a si…

Total physical activitySchoolmedia_common.quotation_subjectschooleducationPhysical activityExercise motivationPhysical Therapy Sports Therapy and Rehabilitation030204 cardiovascular system & hematologystructural equation modellingStructural equation modelingDevelopmental psychologyPhysical education03 medical and health sciences0302 clinical medicinekoululiikuntaEducación Física y DeportivaIntrinsic motivationlcsh:Sports medicineCompetence (human resources)media_commonmotivaatiokuntoliikuntaSelf030229 sport sciencesexercise motivationpsychological needsPsychological needsliikuntapsykologiaStructural equation modellingPsychologylcsh:RC1200-1245human activitiesAutonomyfyysinen aktiivisuus
researchProduct

The prevalence of musculoskeletal pain and use of painkillers among adolescent male ice hockey players in Finland

2014

Participating in competitive sport increases the risk for injuries and musculoskeletal pain among adolescent athletes. There is also evidence that the use of prescription drugs has increased among sport club athletes. The purpose of this study was to evaluate the use of painkillers among young male ice hockey players (IHP) in comparison to schoolboys (controls) and its relation to the prevalence of musculoskeletal pain and problems during activities and sleeping. Information was gathered through a questionnaire, completed by 121 IHP and compared to the responses of 618 age-matched controls. Results showed that monthly existing pain was at 82% for IHP, and 72% for controls, though IHP had st…

Musculoskeletal painmedicine.medical_specialtyHealth (social science)Activities of daily livingLiikuntatiede - Sport and fitness sciencesinjury and preventionBehavioral NeuroscienceIce hockeyMedicineButtocksMedical prescriptionmusculoskeletal painadolescent athletesGeneral Psychologyta515biologybusiness.industryAthletesSisätaudit - Internal medicineta3141Original Articlesbiology.organism_classificationmedicine.anatomical_structurePhysical therapyUpper limbClubbusinesshuman activitiespainkillersHealth Psychology and Behavioral Medicine: An Open Access Journal
researchProduct

Differences in physical activity at recess and school-related social factors in four Finnish lower secondary schools

2017

This study investigated the differences in physical activity (PA) at recess and school-related social factors, and described school PA promotion processes and staff experiences at four lower secondary schools from the Finnish Schools on the Move programme. Recess PA, peer relationships at school, relatedness to school, and school climate were assessed via surveys with eighth-grade students in spring 2011 (n ¼ 385) and spring 2013 (n ¼ 373). Local contact people in the school projects (n ¼ 6), school staff (n ¼ 83) and principals (n ¼ 3) provided information on the PA promotion process via telephone interviews and surveys. Differences in student-level data in years 2011 and 2013 were analyse…

MaleAdolescentmedia_common.quotation_subjecteducationphysical activityOrganizational culturekouluyhteisöSocial EnvironmentPeer GroupEducation03 medical and health sciencesInterpersonal relationship0302 clinical medicinePromotion (rank)Sex FactorsSurveys and QuestionnairesEmployee engagementHumansta516lower secondary schoolsNarrativeInterpersonal Relations030212 general & internal medicineta315ChildStudentssocial factorsExerciseFinlandSocial influencemedia_commonMedical educationSchoolsrecessPublic Health Environmental and Occupational HealthSocial environmentPeer group030229 sport sciencesOriginal ArticlesvälitunnitOrganizational CultureFemaleyläkouluPsychologySocial psychologyfyysinen aktiivisuusHealth Education Research
researchProduct

Motor competence, perceived physical competence, physical fitness, and physical activity within Finnish children

2019

The purpose of this study was to investigate reciprocal relationships among students’ motor competence (MC) (leaping, throwing, catching, jumping skills), perceived physical competence, health‐related fitness (HRF) (20 m shuttle run, push‐up, abdominal muscles endurance tests) and objectively measured moderate‐to‐vigorous physical activity (MVPA). Participants included 422 Grade 5 Finnish children (246 girls). Two separate structural equation models investigated paths (a) from MC through both perceived physical competence and HRF to MVPA, and (b) from MVPA through both perceived physical competence and HRF to MC. Model 1 demonstrated an indirect path from MC through HRF to MVPA and a direct…

MaleMulti-stage fitness testPhysical fitnessPhysical activityphysical activityPhysical Therapy Sports Therapy and Rehabilitationlapset (ikäryhmät)030204 cardiovascular system & hematologymedicine.disease_causeStructural equation modelingDevelopmental psychology03 medical and health sciences0302 clinical medicineJumpingchildrenmedicineHumansOrthopedics and Sports MedicineChildmotoriset taidotExerciseCompetence (human resources)perceived physical competenceFinlandMotor skillbusiness.industryDirect path030229 sport sciencesfyysinen kuntomotor competenceMotor SkillsPhysical FitnessExercise TestFemalebusinessPsychologyfyysinen aktiivisuus
researchProduct

Development of accelerometer-based light to vigorous physical activity in fitness profiles of school-aged children.

2021

This study examined the developmental trajectories of light (LPA) and moderate-to-vigorous physical activity (MVPA) in fitness profiles derived from motor competence, perceived motor competence, health-related fitness, and MVPA behaviour. Locomotor, stability, and object-control skills, muscular and cardiovascular fitness, and physical activity were assessed in 510 (girls 285, boys 225) Finnish school-aged children (Mage = 11.26 ± .33 years) over three years. Physical activity was measured using hip-mounted accelerometers. Fitness profiles were identified using latent profile analysis and the development of physical activity levels across four assessments was analysed with latent growth cur…

educationPhysical activityPhysical Therapy Sports Therapy and Rehabilitationlapset (ikäryhmät)Fitness TrackersDevelopmental psychologyIntermediate groupkouluikäisetlatent growth curve modellatent profile analysisAccelerometryHumansOrthopedics and Sports Medicinemotoriset taidotChildMuscle SkeletalCompetence (human resources)Cardiovascular fitnessExerciseFinlandSchool age childObject controlmittausmenetelmätfyysinen kuntomotor competenceCardiorespiratory FitnessHomogeneousMotor SkillsPhysical Fitnesshealth-related fitnessPerceptionPsychologyfyysinen aktiivisuusScandinavian journal of medicinescience in sportsREFERENCES
researchProduct

Associations of parental physical activity trajectories with offspring's physical activity patterns from childhood to middle adulthood : The Young Fi…

2022

We investigated the association of parental physical activity (PA) trajectories with offspring's youth and adult PA. Self-reported PA data were extracted from the Young Finns Study with three follow-ups for parents between 1980 and 1986 and nine follow-ups for their offspring in youth between 1980 and 2011 (aged 9-39 years, n = 2402) and in adulthood in 2018. Accelerometer-derived PA was quantified in 2018-2020 (aged 43-58 years, n = 1134). Data were analyzed using mixture models and conducted in 2022. We identified three trajectories for fathers and mothers (high-stable activity, 20.2%/16.6%; moderate-stable activity, 50.5%/49.6%; and low-stable activity, 29.4%/33.7%) and four for youth ma…

AdultMaleParentsAdolescentEpidemiologyvaikutuksetTrajectoryMothersphysical activitylapset (ikäryhmät)FathersOffspringnuoret3123 Gynaecology and paediatricsHumansChildExerciseFinlandaskelmittaritoffspringPhysical activityPublic Health Environmental and Occupational Healthparents3142 Public health care science environmental and occupational healthAccelerometeraccelerometervanhemmattrajectoryterveyskäyttäytyminenmittarit (mittaus)ennustettavuusFemale516 Educational sciencesfyysinen aktiivisuus
researchProduct

Adolescents' physical activity at recess and actions to promote a physically active school day in four Finnish schools

2014

The national Finnish Schools on the Move programme support schools with their individual plans to promote school-based physical activity (PA). We examined the changes in adolescents’ recess and overall PA in four lower secondary schools and described the school actions to promote students’ PA and the local contact persons’ perceptions of the effects. Recess and overall PA were assessed four times by anonymous questionnaires from students in grades 7–9 (n = 789) in 2010–12, and local contact persons (n = 7) provided information on school actions with diaries, interviews and surveys. Student data were analysed with descriptive statistics and chi-square tests, and school actions data were anal…

MaleGerontologyAdolescentgenetic structureseducationAdolescent HealthPhysical activityphysical activityHealth PromotionEducationschool daySurveys and QuestionnairesHumansta516ta315ExerciseFinlandActive playSchool Health ServicesFinnish schoolsDescriptive statisticsPublic Health Environmental and Occupational HealthQuantitative content analysisOriginal ArticlesPhysical activity levelHealth promotionAdolescent BehaviorContent analysisFemalePsychologySocial psychologyhuman activitiesAdolescent health
researchProduct

Changes in physical activity and sedentary time in the Finnish Schools on the Move program: a quasi-experimental study

2017

The aim of the Finnish Schools on the Move program is to create a more active and pleasant school day through physical activity (PA). In this quasi-experimental design, we compared changes in moderate-to-vigorous-intensity physical activity (MVPA) and sedentary time (ST) during the school day and outside school hours for Grades 1–9 over two academic years in four program schools and two reference schools. Altogether 319 girls and boys aged 7–15 participated in the study between 2010 and 2012. MVPA and ST were measured four times over the 1.5-year follow-up period for seven consecutive days, using a hip-worn ActiGraph accelerometer. Linear growth curve modeling was used to examine the effect…

Malemedicine.medical_specialtyAdolescenteducationPhysical activityPhysical Therapy Sports Therapy and RehabilitationHealth Promotionschoolsistuminen03 medical and health sciencesLeisure Activities0302 clinical medicinechildrensedentary behaviorSuomiQuasi experimental studymedicineHumansOrthopedics and Sports Medicineadolescents030212 general & internal medicineMotor activityChildta315ExerciseFinlandSedentary timeeducationkoulutmotor activityMove programActigraphy030229 sport sciencesSedentary behaviorActigraphyHealth promotionPhysical therapyFemaleLinear growthPsychologyhuman activitiesfyysinen aktiivisuusDemographyScandinavian Journal of Medicine & Science in Sports
researchProduct

A one-year follow-up of basic psychological need satisfactions in physical education and associated in-class and total physical activity

2020

This study examined basic psychological need satisfactions for competence, autonomy, and social relatedness in physical education (PE) and their contributions to accelerometer-based in-class and total moderate to vigorous physical activity (MVPA) across a one-year follow-up (T1). Participants were 523 students (girls 280, boys 243; mean age = 11.26 ± 0.31) and the data were collected using self-reports and waist-worn accelerometers. The key findings were: (a) competence and social relatedness need satisfaction at baseline (T0) predicted total MVPA at T1 via total MVPA at T0; (b) in-class MVPA at T0 predicted total MVPA at T1 via total MVPA at T0; (c) in-class MVPA was directly associated w…

Total physical activityitsemäärääminenpsykologiset tekijätOne year follow upmedia_common.quotation_subjectschooltarpeeteducationcompetencePhysical Therapy Sports Therapy and Rehabilitationlapset (ikäryhmät)Need satisfactionEducationPhysical educationDevelopmental psychology03 medical and health sciences0302 clinical medicinekoululiikuntaOrthopedics and Sports MedicineautonomyCompetence (human resources)media_commonsocial relatedness05 social sciences050301 educationMean age030229 sport sciencessosiaaliset suhteetcross-lagged modelkompetenssiPsychology0503 educationhuman activitiesAutonomyfyysinen aktiivisuusSocial relatedness
researchProduct

Tracking and Changes in Daily Step Counts among Finnish Adults

2021

Purpose This study aimed to investigate the tracking and changes of steps per day in adults and their determinants over 13 yr. Methods A total of 2195 subjects (1236 women) 30-45 yr of age were randomly recruited from the ongoing Cardiovascular Risk in Young Finns Study in 2007 and were followed up in 2020. Steps per day, including both total and aerobic steps per day, were monitored for seven consecutive days with a pedometer in 2007-2008 and 2011-2012 and with an accelerometer in 2018-2020. Tracking was analyzed using Spearman's correlation. Stability and changes of steps per day over time in both low-active and high-active groups (based on median values) were described by percentage agre…

MaleDEVICESEpidemiologyPhysical Therapy Sports Therapy and RehabilitationpitkittäistutkimusADULTHOODFitness TrackersWalkingLogistic regressionBody Mass Index3123 Gynaecology and paediatricsMedicineHumansOrthopedics and Sports MedicineAMBULATORY ACTIVITYLongitudinal StudiesaskelmittaritaikuisetFinlandMULTILEVEL ANALYSISSTABILITYbusiness.industryFemale sexAge cohortsMiddle AgedActigraphy3142 Public health care science environmental and occupational healthPedometerAmbulatoryFemalebusinessLinear growthBody mass indexAGE COHORTSfyysinen aktiivisuusDemographyMedicine and Science in Sports and Exercise
researchProduct

Test-retest repeatability of questionnaire for pain symptoms for school children aged 10–15 years

2019

Abstract Background and aims There is a growing body of evidence, that pain is common at school age. Less is known about the repeatability of pain questionnaires for children. This study aimed to assess the test-retest repeatability of the Finnish version of the electronic pain questionnaire for school-aged children. Methods Primary (n = 79) and lower secondary (n = 127) schoolchildren aged 10–15 years from two schools from the Jyväskylä region of Finland, filled in an electronic questionnaire twice in an interval of 2 weeks. It captured the frequency of pain symptoms with a five-point Likert-scale questionnaire covering nine areas of the body for the last 3 months. The intraclass correlati…

MaleShouldermedicine.medical_specialtyAdolescentIntraclass correlationkyselytutkimuslapset (ikäryhmät)03 medical and health sciences0302 clinical medicinechildrenSurveys and QuestionnairesHumansMedicine030212 general & internal medicineChildFinlandPain symptomsInternetSchoolsSchool age childbusiness.industrytoistettavuusquestionnaireChronic painReproducibility of Resultskipu030206 dentistryRepeatabilitymedicine.diseaseTest (assessment)Anesthesiology and Pain MedicinePain frequencyPhysical therapyFemaleNeurology (clinical)Chronic PainbusinessHeadNeck
researchProduct

Towards a physically more active lifestyle based on one's own values: study design of a randomized controlled trial for physically inactive adults

2013

Background This randomised controlled trial demonstrates the effectiveness of a value-based intervention program to encourage a physically more active lifestyle among physically inactive adults aged 30 to 50 years. The conceptual framework of the program is based on an innovative behavioural therapy called Acceptance and Commitment Therapy (ACT) that aims to increase an individual’s psychological flexibility and support behaviour change towards a higher quality and more meaningful life. Methods Participants will be randomly allocated to a feedback group (FB) or an Acceptance and Commitment based (ACT + FB) group. Both the groups will receive written feedback about their objectively measured…

GerontologyAdultMalemedicine.medical_treatmenthyväksymis- ja omistautumisterapiaEffectivenessPersonal SatisfactionAcceptance and commitment therapyMeaningful lifePsychological well-beinglaw.inventionStudy ProtocolRandomized controlled trialPsykologinen hyvinvointilawSurveys and QuestionnairesmedicineHumansAdultsBehaviourAcceptance and Commitment TherapykäyttäytyminenExerciseaikuisetSedentary lifestyleHOTMotivationCognitive Behavioral Therapybusiness.industryPhysical activitytuloksellisuusPublic Health Environmental and Occupational HealthFlexibility (personality)Middle AgedvaikuttavuusACTPsychological well-beingCognitive therapyFemaleBiostatisticsSedentary BehaviorbusinessAttitude to Healthfyysinen aktiivisuus
researchProduct

Female reproductive factors are associated with objectively measured physical activity in middle-aged women

2017

Physical activity improves health and may delay the onset of several chronic diseases. For women in particular, the rate of these diseases accelerates at middle age; therefore it is important to identify the determinants of health-enhancing physical activity during midlife in this population. In this study, we focused on determinants that are unique to the female sex, such as childbearing and menopause. The main objective was to characterize the level of physical activity and differences between active and inactive middle-aged Finnish women. In addition, we examined the association of physical activity with female reproductive factors at midlife. The study population consisted of 647 women …

vaihdevuodetPhysiologyMaternal Healthlcsh:Medicinephysical activitymenopauseMiscarriageBody Mass Index0302 clinical medicineMathematical and Statistical TechniquesPregnancyAccelerometryMedicine and Health SciencesMedicinePublic and Occupational Healthpelvic floor dysfunction030212 general & internal medicinelcsh:Scienceta315Reproductive HistoryFinlandeducation.field_of_study030219 obstetrics & reproductive medicineMultidisciplinaryPelvic floorObstetrics and Gynecologyta3142Middle AgedMenopausemedicine.anatomical_structurePhysiological ParametersCohortPhysical SciencesEngineering and TechnologyRegression AnalysisFemaleStatistics (Mathematics)Research ArticleUrologyPopulationLinear Regression AnalysisResearch and Analysis MethodsPelvic Floor Disordersmiddle-aged women03 medical and health sciencesPelvic floor dysfunctionPain ManagementHumansObesityStatistical MethodseducationExerciseIncontinencebusiness.industryBody Weightlcsh:RBiology and Life SciencesMyalgiaPelvic Floormedicine.diseaseta3123Middle agePregnancy ComplicationsLight intensityWomen's Healthlcsh:QElectronicsAccelerometersbusinessBody mass indexMathematicsDemographyPLoS ONE
researchProduct

Predictive Strength of Physical Education-Centered Physical Literacy Indicators on Physical Activity

2021

This study examined the predictive strength of selected physical education (PE)-centered physical literacy indicators on elementary school students’ accelerometer-measured moderate to vigorous intensity physical activity (PA). The study was a cross-sectional study with a sample of 450 Finnish children (M = 11.26 [0.32]; nfemales = 194; nmales = 256). Data on a set of predictor variables (motor competence, in-class PE moderate- to vigorous-intensity PA [MVPA], health-related fitness, and PE motivation and enjoyment) and total MVPA as a single outcome variable were collected. The entire model explained almost 30% of MVPA (R2adj = .298). Cardiorespiratory endurance (β = 0.42, 95% confidence in…

educationPhysical activityPhysical Therapy Sports Therapy and Rehabilitationlapset (ikäryhmät)030229 sport sciencesmoderate to vigorous intensityEducationPhysical educationDevelopmental psychology03 medical and health sciencesfyysinen kunto0302 clinical medicinePhysical literacykoululiikuntahealth-related fitnessaccelerometryOrthopedics and Sports Medicine030212 general & internal medicinePsychologymotoriset taidothuman activitiesfyysinen aktiivisuusmotor competency
researchProduct

Physical Activity, Sedentary Behavior, and Academic Performance in Finnish Children

2013

Purpose: This study aimed to determine the relationships between objectively measured and self-reported physical activity, sedentary behavior, and academic performance in Finnish children. Methods: Two hundred and seventy-seven children from five schools in the Jyväskylä school district in Finland (58% of the 475 eligible students, mean age = 12.2 yr, 56% girls) participated in the study in the spring of 2011. Self-reported physical activity and screen time were evaluated with questions used in the WHO Health Behavior in School-Aged Children study. Children’s physical activity and sedentary time were measured objectively by using an ActiGraph GT1M/GT3X accelerometer for seven consecutive da…

GerontologyEducational measurementkouluikäoppiminenmoderate-to-vigorous physical activityPhysical activityruutuaikaPhysical Therapy Sports Therapy and RehabilitationSedentary behaviorAcademic achievementSchool districtacademic achievementScreen timeschool ageLinear regressionOrthopedics and Sports MedicineAnalysis of variancekoulumenestysta315Psychologyfyysinen aktiivisuusta515Medicine & Science in Sports & Exercise
researchProduct

Longitudinal associations among cardiorespiratory and muscular fitness, motor competence and objectively measured physical activity.

2019

Abstract Objectives This study aimed to investigate cross-lagged associations in motor competence, cardiorespiratory fitness, muscular fitness and accelerometer-based moderate-to-vigorous physical activity (MVPA) engagement. Design One-year prospective follow-up study. Methods A sample was 491 (275 girls; M at baseline = 11.27, SD = .32) Finnish physical education students. Students’ motor competence was assessed by (1) two-legged jumping from side to side test, (2) throwing-catching combination test and (3) 5-leaps test. Their cardiorespiratory fitness was analyzed by a 20-m shuttle run test and muscular fitness by curl-up and push-up tests. Additionally, students’ MVPA was measured object…

Malemedicine.medical_specialtyeducationPhysical activityphysical activityPhysical Therapy Sports Therapy and Rehabilitationmedicine.disease_causePhysical education03 medical and health sciences0302 clinical medicineJumpingMedicineHumansOrthopedics and Sports Medicine030212 general & internal medicineProspective Studiesmotoriset taidotChildMuscle SkeletalStudentsCompetence (human resources)ExerciseShuttle run testFinlandcardiorespiratory fitnessbusiness.industryCardiorespiratory fitness030229 sport sciencesmuscular fitnessmotor competenceCardiorespiratory FitnessMotor Skillssydän- ja verisuonitauditPhysical therapyFemalelihaskuntobusinessfyysinen aktiivisuusFollow-Up StudiesJournal of science and medicine in sport
researchProduct

Longitudinal associations of fundamental movement skills with objectively measured physical activity and sedentariness during school transition from …

2017

Abstract Objectives This study aimed to investigate cross-lagged associations of leaping skill and throwing–catching skills with objectively measured moderate-to-vigorous physical activity (MVPA) and sedentary time (ST) during school transition from upper primary (Grade 6) to lower secondary school (Grade 7). Design This study is a one-year prospective follow-up study within Finnish school settings. Students’ MVPA, ST, leaping skill and throwing–catching skills were measured at Grade 6 and subsequently at Grade 7. Methods A sample of 336 students (163 girls, 173 boys; M age = 12.0 years, SD = 0.4 at Grade 6 participated in the study. Students’ MVPA and ST were measured objectively by hip-wo…

MaleeducationPhysical activityphysical activityPhysical Therapy Sports Therapy and RehabilitationpitkittäistutkimusStructural equation modelingDevelopmental psychologyliikuntataidot03 medical and health sciences0302 clinical medicinekouluikäisetNegatively associatedAccelerometryHumansOrthopedics and Sports MedicineProspective Studies030212 general & internal medicineta315ChildExerciseFinlandfundamental movement skillsSchool educationschool transitionSedentary timeSchools030229 sport sciencesSkill developmentTest (assessment)Motor SkillsExercise TestFemaleSedentary BehaviorPsychologyhuman activitiesThrowingfyysinen aktiivisuusFollow-Up Studies
researchProduct

Identifying childhood movement profiles and tracking physical activity and sedentary time across 1 year

2020

Sedentary timemedicine.medical_specialtyPhysical medicine and rehabilitationMovement (music)medicinePhysical activityTracking (education)PsychologyTranslational Sports Medicine
researchProduct

Recess physical activity and school-related social factors in Finnish primary and lower secondary schools: cross-sectional associations.

2014

Abstract Background Participation in physical activities provides students with opportunities for social interaction and social skills development. The purpose of this study was to investigate the associations of students’ recess physical activity with school-related social factors. Methods Data were collected in 19 schools countrywide in autumn 2010, and 1463 students from grades 4 and 5 (primary school) and from grades 7 and 8 (lower secondary school) completed an anonymous questionnaire. Multiple linear regression analysis was used to investigate whether self-reported physical activity at recess was associated with peer relationships at school, relatedness to school and school clim…

MaleSchoolPediatricsmedicine.medical_specialtyAdolescentCross-sectional studySchool climateeducationMotor ActivityAdolescentsPeer GroupDevelopmental psychologySocial skillsSurveys and QuestionnairesAdaptation PsychologicalmedicineHumansSocial ChangeChildStudentsRecessPeer relationshipsChildrenFinlandSchool Health ServicesSchoolsbusiness.industryPhysical activityPublic healthSocial changePublic Health Environmental and Occupational HealthPeer groupSocial relationTest (assessment)Play and PlaythingsCross-Sectional StudiesSocial factorsFemaleRelatednessBiostatisticsbusinessResearch ArticleBMC public health
researchProduct

The Longitudinal Associations of Fitness and Motor Skills with Academic Achievement

2019

Supplemental digital content is available in the text.

GerontologyMaleopintomenestysAdolescentPhysical fitnessMEDLINEPhysical Therapy Sports Therapy and RehabilitationAcademic achievementFUNDAMENTAL MOVEMENT SKILLS03 medical and health sciences0302 clinical medicinekouluikäisetMUSCULAR FITNESSHumansACADEMIC PERFORMANCEOrthopedics and Sports MedicineLongitudinal StudiesChildMuscle Skeletalmotoriset taidotMotor skillFinlandfundamental movement skillsaerobic fitnessAcademic Successbusiness.industry4. EducationFollow up studiesApplied Sciencesacademic performanceCardiorespiratory fitness030229 sport sciencesAEROBIC FITNESSfyysinen kuntomuscular fitnessCardiorespiratory FitnessMotor SkillsPhysical FitnessComputingMethodologies_DOCUMENTANDTEXTPROCESSINGFemaleseurantatutkimusbusinessPsychologyFollow-Up Studies
researchProduct

Differences in the Physical Activity, Sedentary Time, and BMI of Finnish Grade 5 Students

2018

Background: This study examined the distribution of objectively measured physical activity (PA) and sedentary time of fifth-grade students during school, leisure time, and physical education (PE) classes. Demographic, anthropometric, and PA data were collected from 17 representative Finnish schools. Methods: To estimate the PA and sedentary time, participants (N = 592) wore wGT3X-BT ActiGraphs for 7 consecutive days. Comparisons were made between genders and different BMI groups. Results: From the study sample, 43.7% met the moderate to vigorous PA (MVPA) guidelines. Participants spent 62.2% of the day sedentary and 8.2% in moderate and vigorous activities. Boys performed more MVPA than gir…

MaleLeisure timeeducationPhysical activityOverweightliikuntaBody weightPhysical educationBody Mass Indexistuminen03 medical and health sciencesbody weight0302 clinical medicineLeisure ActivitiesSex FactorsnuoretAccelerometrymedicineaccelerometryHumansOrthopedics and Sports Medicine030212 general & internal medicineObesitypaino (fysiikka)painoindeksiChildStudentsExerciseFinlandSedentary timePhysical Education and TrainingSchoolsAnthropometrybusiness.industry030229 sport sciencesAnthropometryphysical educationadolescentFemalemedicine.symptomSedentary Behaviorbusinessfyysinen aktiivisuusDemography
researchProduct

Associations of active commuting to school in childhood and physical activity in adulthood

2023

AbstractThis study examined whether active commuting to school in childhood and adolescence predicted active commuting to work and overall physical activity (PA) in adulthood. Participants from the Young Finns Study (N = 2436) were aged 9–18 years in 1980 and followed up until 2018/2020. Their commuting modes to school were assessed with a self-reported questionnaire in 1980. Adulthood PA was assessed through self-reports regarding commuting modes to work (2001–2018), leisure-time physical activity (LTPA) (2001–2018), and objectively measured daily steps (2007–2018/2020). Associations between childhood commuting and adulthood PA were evaluated using regression analyses and multilevel models…

Multidisciplinaryaikuisuusnuoruuspitkittäistutkimuslapsuuskoulumatkatfyysinen aktiivisuuspyöräilyhyötyliikuntatyömatkat (työpaikalle)kävely
researchProduct

Continuity and changes in commuting mode and influence on physical activity, BMI and waist circumference among Finnish adults

2022

Regular physical activity (PA) has been found to be important for cardiovascular health and longevity. However, notable proportion of adult population does not meet the national PA recommendations. Active transport is one domain of physical activity, that could be a time-efficient way to increase PA and reach the national recommendations. Additionally, it could have a positive effect to body composition. nonPeerReviewed

BMIactive commutingphysical activityterveyshyödytpainoindeksifyysinen aktiivisuushyötyliikuntaobjective measurementtyömatkat (työpaikalle)
researchProduct

Physical activity, screen time and the incidence of neck and shoulder pain in school-aged children

2022

This study investigated the associations of accelerometer-measured physical activity, sedentary time and screen time with the incidence of neck and shoulder pain in school-aged children over a two-year follow-up. Children (aged 10–15) were measured at baseline 2013 (T0) (n = 970) and at follow-ups 2014 (T1) and 2015 (T2). Neck and shoulder pain frequency and screen time were determined with a web-based questionnaire. Daytime moderate to vigorous physical activity and sedentary time were measured with an accelerometer. Logistic regression was applied, and the results were adjusted for age, gender, body mass index and bedtime. Accelerometer-measured physical activity or sedentary time at base…

istuminenpelaaminenesiintyvyyshartiatniskaruutuaikakipukoululaisetlapset (ikäryhmät)liikuntaverkkopelitfyysinen aktiivisuus
researchProduct

Physical activity and sedentary time during physical education lessons between different physical activity groups of a sample of finnish 11-year-old …

2019

Problem statement: Insufficient PA is rising concern in modern society. Physical education as a compulsory subject allows all students to engage physical activity. However, the activity levels may vary during the physical education lesson depending on the motivation of students. Purpose: The purpose of this study was to determine the amount of time spent in light physical activity, moderate to vigorous physical activity and sedentary activity by a sample of Finnish fifth grade students during physical education lessons. Approach: A cohort of 407 Finnish students' (177 boys, 232 girls) participated to study. To determine activity, participants wore GTX3 Actigraphs for seven consecutive days.…

accelerometerphysical educationchildrenkoululiikuntaeducationphysical activitylapset (ikäryhmät)fyysinen aktiivisuus
researchProduct

Lasten ja nuorten liikuntakäyttäytyminen Suomessa : LIITU-tutkimuksen tuloksia 2018

2019

nuoretkoululiikuntaterveyskäyttäytyminenliikuntatottumuksetlapset (ikäryhmät)liikuntaliikuntaharrastusfyysinen aktiivisuus
researchProduct

Nuorten liikuntakäyttäytyminen Suomessa : LIITU-tutkimuksen tuloksia 2020

2021

motivaatiopenkkiurheilupelaaminenvideopelitsosiaalinen tukikilpaurheiluterveysosaaminenliikuntaerityisliikuntaliikuntavammat (liikunnassa syntyneet)arvot (käsitykset)koululiikuntanuoretterveyskäyttäytyminenkiusaaminenliikuntaharrastusfyysinen aktiivisuus
researchProduct

The association of childhood commuting modes and physical activity in adult age

2022

Background Physically active lifestyle prevents and contributes to managing non-communicable diseases. Childhood physical activities have shown to associate with physically active lifestyle in adulthood. More research on which childhood physical activity modes associate with physical activity in later life is still needed. Within the present study, we examined how physically active commuting to school in childhood contributed to overall physical activity in adulhood. Methods The participants (N = 3596) were from the population-based, longitudinal Cardiovascular Risks in Young Finns Study. Questionnaires were used in assessing subjects' childhood (1980) and adulthood (2001-2018) physical act…

active commutinglongitudinal studyaccelometer-measured physical activitypitkittäistutkimusliikuntaself-reported physical activityfyysinen aktiivisuustyömatkat (työpaikalle)
researchProduct

Identifying childhood movement profiles and tracking physical activity and sedentary time across 1 year

2020

This study identified movement profiles in childhood and tracked longitudinal changes in moderate‐to‐vigorous physical activity and sedentary time across identified profiles. A sample consisted of 491 Finnish 5th Grade children (girls 275, boys 216; Mage = 11.27 ± .32). A latent profile analysis strategy was used to identify homogenous movement profiles that included measures of motor competence, perceived competence, and cardiorespiratory and muscular fitness. To examine a one‐year changes in moderate‐to‐vigorous physical activity and sedentary time among movement profiles, a mixed between‐within subjects analysis of variance with Tukey's post hoc ‐tests was conducted. Results revealed thr…

fyysinen kuntomotor competencelatent profile analysislapset (ikäryhmät)health‐related fitnessliikuntamotoriset taidotperceived physical competencefyysinen aktiivisuus
researchProduct