0000000001119569

AUTHOR

Kieran Flanagan

showing 62 related works from this author

The Collinear Resonance Ionization Spectroscopy (CRIS) experimental setup at CERN-ISOLDE

2012

The CRIS setup at CERN-ISOLDE is a laser spectroscopy experiment dedicated to the high-resolution study of the spin, hyperfine structure and isotope shift of radioactive nuclei with low production rates (a few per second). It combines the Doppler-free resolution of the in-flight collinear geometry with the high detection efficiency of resonant ionisation. A recent commissioning campaign has demonstrated a 1% experimental efficiency, and as low as a 0.001% non-resonant ionisation. The current status of the experiment and its recent achievements with beams of francium isotopes are reported. The first identified systematic effects are discussed. publisher: Elsevier articletitle: The Collinear …

Nuclear and High Energy Physics[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]chemistry.chemical_element[PHYS.NEXP]Physics [physics]/Nuclear Experiment [nucl-ex]7. Clean energy01 natural sciencesFranciumIonization0103 physical sciencesPhysics::Atomic PhysicsLaser spectroscopyNuclear Experiment010306 general physicsSpin (physics)SpectroscopyInstrumentationHyperfine structureComputingMilieux_MISCELLANEOUSLarge Hadron ColliderIsotopeRadioactive decay spectroscopy010308 nuclear & particles physicsIon beam purificationIsotope shiftchemistry13. Climate actionPhysics::Accelerator PhysicsHyperfine structureAtomic physicsRadioactive decayNuclear Instruments and Methods in Physics Research Section B: Beam Interactions with Materials and Atoms
researchProduct

Resonance ionization schemes for high resolution and high efficiency studies of exotic nuclei at the CRIS experiment

2019

© 2019 This paper presents an overview of recent resonance ionization schemes used at the Collinear Resonance Ionization Spectroscopy (CRIS) setup located at ISOLDE, CERN. The developments needed to reach high spectral resolution and efficiency will be discussed. Besides laser ionization efficiency and high resolving power, experiments on rare isotopes also require low-background conditions. Ongoing developments that aim to deal with beam-related sources of background are presented. ispartof: Nuclear Instruments & Methods In Physics Research Section B-Beam Interactions With Materials And Atoms vol:463 pages:398-402 ispartof: location:SWITZERLAND, CERN, Geneva status: published

Nuclear and High Energy PhysicsHigh resolution7. Clean energy01 natural sciencesResonance ionization spectroscopylaw.inventionNuclear physicslawIonization0103 physical sciencesDalton Nuclear InstituteNuclear structurePhysics::Atomic PhysicsSpectral resolution010306 general physicsSpectroscopyInstrumentationPhysicsLarge Hadron Collider010308 nuclear & particles physicsDelayed ionizationNuclear structureLaser3. Good healthResearchInstitutes_Networks_Beacons/dalton_nuclear_instituteResonance ionizationHigh-resolution laser spectroscopyNuclear Instruments and Methods in Physics Research Section B: Beam Interactions with Materials and Atoms
researchProduct

Laser and decay spectroscopy of the short-lived isotope Fr214 in the vicinity of the N=126 shell closure

2016

PhysicsIsotope010308 nuclear & particles physicslaw0103 physical sciencesShell (structure)Closure (topology)Atomic physics010306 general physicsLaserSpectroscopy01 natural scienceslaw.inventionPhysical Review C
researchProduct

Measurement and microscopic description of odd-even staggering of charge radii of exotic copper isotopes

2020

Isotopes with an odd number of neutrons are usually slightly smaller in size than their even-neutron neighbours. In charge radii of short-lived copper isotopes, a reduction of this effect is observed when the neutron number approaches fifty. The mesoscopic nature of the atomic nucleus gives rise to a wide array of macroscopic and microscopic phenomena. The size of the nucleus is a window into this duality: while the charge radii globally scale as $A^{1/3}$, their evolution across isotopic chains reveals unanticipated structural phenomena [1-3]. The most ubiquitous of these is perhaps the Odd-Even Staggering (OES) [4]: isotopes with an odd number of neutrons are usually smaller in size than …

Nuclear Theorynucl-th[PHYS.NUCL]Physics [physics]/Nuclear Theory [nucl-th]Astrophysics::High Energy Astrophysical PhenomenaNuclear TheoryGeneral Physics and AstronomyFOS: Physical scienceskupari[PHYS.NEXP]Physics [physics]/Nuclear Experiment [nucl-ex]nucl-ex01 natural sciences7. Clean energyEffective nuclear chargeNuclear physicsNuclear Theory (nucl-th)0103 physical sciencesexperimental nuclear physicsNeutronNuclear Physics - ExperimentNuclear Experiment (nucl-ex)010306 general physicsNuclear ExperimentNuclear ExperimentPhysicsMass numberisotoopitIsotope010308 nuclear & particles physicsNuclear matter13. Climate actionNeutron numberNuclear Physics - Theorytheoretical nuclear physicsAtomic numberydinfysiikkaNuclear density
researchProduct

Laser Spectroscopy of Neutron-Rich Hg207,208 Isotopes: Illuminating the Kink and Odd-Even Staggering in Charge Radii across the N=126 Shell Closure

2021

The mean-square charge radii of $^{207,208}$Hg ($Z=80, N=127,128$) have been studied for the first time and those of $^{202,203,206}$Hg ($N=122,123,126$) remeasured by the application of in-source resonance-ionization laser spectroscopy at ISOLDE (CERN). The characteristic \textit{kink} in the charge radii at the $N=126$ neutron shell closure has been revealed, providing the first information on its behavior below the $Z=82$ proton shell closure. A theoretical analysis has been performed within relativistic Hartree-Bogoliubov and non-relativistic Hartree-Fock-Bogoliubov approaches, considering both the new mercury results and existing lead data. Contrary to previous interpretations, it is d…

PhysicsProtonNuclear TheoryShell (structure)General Physics and AstronomyCharge (physics)Coupling (probability)01 natural sciencesAtomic orbitalPairing0103 physical sciencesNeutronAtomic physicsNuclear Experiment010306 general physicsSpectroscopyPhysical Review Letters
researchProduct

Precision measurements of the charge radii of potassium isotopes

2019

International audience; Precision nuclear charge radii measurements in the light-mass region are essential for understanding the evolution of nuclear structure, but their measurement represents a great challenge for experimental techniques. At the Collinear Resonance Ionization Spectroscopy (CRIS) setup at ISOLDE-CERN, a laser frequency calibration and monitoring system was installed and commissioned through the hyperfine spectra measurement of $^{38–47}$K. It allowed for the extraction of the hyperfine parameters and isotope shifts with better than 1 MHz precision. These results are in excellent agreement with available literature values and they demonstrate the suitability of the CRIS tec…

PhysicsIsotope010308 nuclear & particles physicsNuclear structure[PHYS.NEXP]Physics [physics]/Nuclear Experiment [nucl-ex]Nuclear Structure01 natural sciences7. Clean energyEffective nuclear chargeSpectral linenuclear charge distributionIsotopes of potassium0103 physical sciencesCalibrationlaser spectroscopyNuclear Physics - Experimentfine and hyperfine structurePhysics::Atomic Physicsatomic spectraAtomic physics010306 general physicsSpectroscopyydinfysiikkaHyperfine structurePhysical Review C
researchProduct

Nuclear mean-square charge radii of63,64,66,68−82Ga nuclei: No anomalous behavior atN=32

2012

Collinear laser spectroscopy was performed on the ${}^{63,64,66,68\ensuremath{-}82}$Ga isotopes with neutron numbers from $N=32$ to $N=51$. These measurements were carried out at the ISOLDE radioactive ion beam facility at CERN. Here we present the nuclear mean-square charge radii extracted from the isotope shifts and, for the lighter isotopes, new spin and moment values. New ground-state nuclear spin and moments were extracted from the hyperfine spectra of ${}^{63,70}$Ga, measured on an atomic transition in the neutral atom. The ground-state spin of ${}^{63}$Ga is determined to be $I=3/2$. Analysis of the trend in the change in mean-square charge radii of the gallium isotopes demonstrates …

PhysicsNuclear and High Energy PhysicsIsotope010308 nuclear & particles physicschemistry.chemical_elementCharge (physics)7. Clean energy01 natural sciencesSpectral linechemistry0103 physical sciencesNeutronPhysics::Atomic PhysicsAtomic physicsGalliumNuclear Experiment010306 general physicsSpin (physics)SpectroscopyHyperfine structurePhysical Review C
researchProduct

Nuclear moments put a new spin on the structure of 131In

2021

Abstract In spite of the high-density and strongly correlated nature of the atomic nucleus, experimental and theoretical evidence suggests that around particular 'magic' numbers of nucleons, nuclear properties are governed by a single unpaired nucleon1,2. A microscopic understanding of the extent of this behaviour and its evolution in neutron-rich nuclei remains an open question in nuclear physics 3-5. A textbook example is the electromagnetic moments of indium (Z = 49) 6, which are dominated by a hole with respect to the proton magic number Z = 50 nucleus. They exhibit a remarkably constant behaviour over a large range of odd-mass isotopes, previously interpreted as pure "single-particle b…

PhysicsCondensed matter physicsNuclear TheoryStructure (category theory)Nuclear ExperimentSpin-½
researchProduct

Isotope shifts in natural cerium

2003

High resolution crossed beam resonance fluorescence laser spectroscopy has been performed on an atomic beam of naturally occurring cerium, and isotope shifts have been measured in several transitions. Changes in mean square charge radius, δ〈r 2〉, have been extracted using the King plot technique and show the characteristic increase at the N = 82 neutron shell closure. The measurements form the basis for further investigations of radioactive isotopes and isomers on both sides of the shell closure.

CeriumMaterials scienceResonance fluorescencechemistryIsotopeCharge radiusPhysics::Atomic and Molecular ClustersShell (structure)chemistry.chemical_elementNeutronAtomic physicsSpectroscopyBeam (structure)
researchProduct

Early onset of deformation in the neutron-deficient polonium isotopes

2012

In-source laser spectroscopy has been performed at CERN-ISOLDE with the RILIS laser ion source on Po-191-204,Po-206,Po-208-211,Po-216,Po-218. New information on the beta decay of Po-199 were extracted in the process, challenging previous results. Large-scale atomic calculations were performed to extract the changes in the mean-square charge radius delta from the isotope shifts. The delta for the even-A isotopes reveal a large deviation from the spherical droplet model for N < 116.

HistoryIsotopeChemistrychemistry.chemical_elementLaserIon sourceComputer Science ApplicationsEducationlaw.inventionlawCharge radiusNeutronPhysics::Atomic PhysicsDeformation (engineering)Atomic physicsNuclear ExperimentSpectroscopyPoloniumJournal of Physics: Conference Series
researchProduct

New developments of the in-source spectroscopy method at RILIS/ISOLDE

2013

At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi…

Nuclear and High Energy PhysicsIon beamNuclear physics[PHYS.NEXP]Physics [physics]/Nuclear Experiment [nucl-ex]01 natural sciences7. Clean energyISOLTRAPIonNuclear physicsIonization0103 physical sciencesPhysics::Atomic PhysicsLaser spectroscopy010306 general physicsSpectroscopyNuclear ExperimentInstrumentationHyperfine structureRresonance laser ionization010308 nuclear & particles physicsChemistryResonanceIon sourceIsotope shiftHyperfine structureAtomic physics
researchProduct

A dedicated decay-spectroscopy station for the collinear resonance ionization experiment at ISOLDE

2013

A newdecay-spectroscopystation(DSS)has been developed to be coupled to the collinear resonance ionization spectroscopy (CRIS) beam line at CERN-ISOLDE. The system uses a rotatable wheel with ten 20 mg=cm2 carbon foils as beam implantation sites for the efficient measurement of charged decay products. Silicon detectors are placed on either side of the carbon foil in an optimal geometry to cover a large solid angle for detecting these charged particles. In addition to the silicon detectors at the on-beam axis position, a second pair of off-beam axis detectors are placed at the wheel position 108 deg. away, allowing longer-lived species to be studied. Up to three high purity germanium detector…

PhysicsNuclear and High Energy PhysicsSilicon010308 nuclear & particles physicsPhysics::Instrumentation and DetectorsUltra-high vacuumGamma raychemistry.chemical_elementGermaniumFission products[PHYS.NEXP]Physics [physics]/Nuclear Experiment [nucl-ex]01 natural sciencesCharged particleBeamlinechemistry0103 physical sciencesPhysics::Accelerator PhysicsAlpha decaygamma-rayAtomic physics010306 general physicsSpectroscopyLaser-assisted decay spectroscopyInstrumentationBeam (structure)
researchProduct

A compact linear Paul trap cooler buncher for CRIS

2020

A gas-filled linear Paul trap for the Collinear Resonance Ionisation Spectroscopy (CRIS) experiment at ISOLDE, CERN is currently under development. The trap is designed to accept beam from both ISOLDE target stations and the CRIS stable ion source. The motivation for the project along with the current design, simulations and future plans, will be outlined. peerReviewed

Nuclear and High Energy Physicsspektroskopiatutkimuslaitteet7. Clean energy01 natural sciencesTrap (computing)Nuclear physics0103 physical sciences3D-tulostusDalton Nuclear InstituteNuclear Experiment010306 general physicsInstrumentationPhysicsLarge Hadron Collider010401 analytical chemistryion trapping3D printingIon source0104 chemical sciencesResearchInstitutes_Networks_Beacons/dalton_nuclear_institutelaser spectroscopyPhysics::Accelerator PhysicsIon trapydinfysiikkaBeam (structure)Nuclear Instruments and Methods in Physics Research Section B: Beam Interactions with Materials and Atoms
researchProduct

CRIS: A new method in isomeric beam production

2013

The Collinear Resonance Ionization Spectroscopy (CRIS) experiment at ISOLDE, CERN, uses laser radiation to stepwise excite and ionize an atomic beam for the purpose of ultra-sensitive detection of rare isotopes, and hyperfine-structure measurements. The technique also offers the ability to purify an ion beam that is heavily contaminated with radioactive isobars, including the ground state of an isotope from its isomer, allowing decay spectroscopy on nuclear isomeric states to be performed. The isomeric ion beam is selected by resonantly exciting one of its hyperfine structure levels, and subsequently ionizing it. This selectively ionized beam is deflected to a decay spectroscopy station (DS…

Ion beamRadioactive decay spectroscopyPhysicsQC1-999chemistry.chemical_elementIon beam purificationFranciumSemiconductor detectorIsotope shiftchemistryIonizationPhysics::Atomic and Molecular ClustersPhysics::Accelerator PhysicsNeutronHyperfine structurePhysics::Atomic PhysicsAtomic physicsLaser spectroscopySpectroscopyNuclear ExperimentBeam (structure)Radioactive decay
researchProduct

An ion cooler-buncher for high-sensitivity collinear laser spectroscopy at ISOLDE

2008

International audience; A gas-filled segmented linear Paul trap has been installed at the focal plane of the high-resolution separator (HRS) at CERN-ISOLDE. As well as providing beams with a reduced transverse emittance, this device is also able to accumulate the ions and release the sample in bunches with a well-defined time structure. This has recently permitted collinear laser spectroscopy with stable and radioactive bunched beams to be demonstrated at ISOLDE. Surface-ionized 39, 44, 46K and 85Rb beams were accelerated to 30keV, mass separated and injected into the trap for subsequent extraction and delivery to the laser setup. The ions were neutralized in a charge exchange cell and exci…

PhysicsNuclear and High Energy PhysicsPhotomultiplierPhotonIon beam010308 nuclear & particles physics[PHYS.NEXP]Physics [physics]/Nuclear Experiment [nucl-ex]Laser01 natural sciences7. Clean energyIonlaw.inventionBuncheslaw0103 physical sciencesPhysics::Accelerator PhysicsThermal emittancePhysics::Atomic PhysicsIon trapAtomic physics010306 general physics
researchProduct

Simple Nuclear Structure inCd111–129from Atomic Isomer Shifts

2016

Isomer shifts have been determined in ^{111-129}Cd by high-resolution laser spectroscopy at CERN-ISOLDE. The corresponding mean square charge-radii changes, from the 1/2^{+} and the 3/2^{+} ground states to the 11/2^{-} isomers, have been found to follow a distinct parabolic dependence as a function of the atomic mass number. Since the isomers have been previously associated with simplicity due to the linear mass dependence of their quadrupole moments, the regularity of the isomer shifts suggests a higher order of symmetry affecting the ground states in addition. A comprehensive description assuming nuclear deformation is found to accurately reproduce the radii differences in conjunction wi…

Mass numberPhysics010308 nuclear & particles physicsNuclear structureGeneral Physics and AstronomyOrder (ring theory)01 natural sciencesSymmetry (physics)0103 physical sciencesQuadrupolePhysics::Atomic and Molecular ClustersDensity functional theoryAtomic physics010306 general physicsSpectroscopyLine (formation)Physical Review Letters
researchProduct

Ground-state spins and moments of72,74,76,78Ga nuclei

2011

Laser spectroscopy was performed on the ${}^{72,74,76,78}$Ga isotopes at On-Line Isotope Mass Separator (ISOLDE) facility, CERN. Ground-state nuclear spins and moments were extracted from the measured hyperfine spectra. The results are compared to shell-model calculations, which provide a detailed probe of the nuclear wave function. The spin is established from the shape of the hyperfine structure and the parity inferred from a comparison of shell-model calculations with the measured nuclear moments. The ground states of ${}^{76,78}$Ga are both assigned a spin and parity of ${I}^{\ensuremath{\pi}}={2}^{\ensuremath{-}}$, while ${}^{74}$Ga is tentatively assigned as ${I}^{\ensuremath{\pi}}={3…

PhysicsNuclear and High Energy PhysicsAngular momentumSpinsMagnetic moment010308 nuclear & particles physics01 natural sciences7. Clean energySpectral line0103 physical sciencesAtomic physicsNuclear Experiment010306 general physicsWave functionGround stateSpectroscopyHyperfine structurePhysical Review C
researchProduct

Spin and Magnetic Moment ofMg33: Evidence for a Negative-Parity Intruder Ground State

2007

We report on the first determination of the nuclear ground-state spin of $^{33}\mathrm{Mg}$, $I=3/2$, and its magnetic moment, $\ensuremath{\mu}=\ensuremath{-}0.7456(5)\text{ }{\ensuremath{\mu}}_{N}$, by combining laser spectroscopy with nuclear magnetic resonance techniques. These values are inconsistent with an earlier suggested 1 particle-1 hole configuration and provide evidence for a 2 particle-2 hole intruder ground state with negative parity. The results are in agreement with an odd-neutron occupation of the $3/2\text{ }[321]$ Nilsson orbital at a large prolate deformation. The discussion emphasizes the need of further theoretical and experimental investigation of the island of inver…

BaryonPhysicsAngular momentumMagnetic momentCondensed matter physicsIsland of inversionHadronGeneral Physics and AstronomyNucleonGround stateHyperfine structurePhysical Review Letters
researchProduct

Tin resonance-ionization schemes for atomic- And nuclear-structure studies

2020

This paper presents high-precision spectroscopic measurements of atomic tin using five different resonance-ionization schemes performed with the collinear resonance-ionization spectroscopy technique. Isotope shifts were measured for the stable tin isotopes from the $5{s}^{2}5{p}^{2}\phantom{\rule{0.28em}{0ex}}^{3}{P}_{0,1,2}$ and ${}^{1}{S}_{0}$ to the $5{s}^{2}5p6s\phantom{\rule{0.28em}{0ex}}^{1}{P}_{1},^{3}{P}_{1,2}$ and $5{s}^{2}5p7s{\phantom{\rule{0.28em}{0ex}}}^{1}{P}_{1}$ atomic levels. The magnetic dipole hyperfine constants ${A}_{\mathrm{hf}}$ have been extracted for six atomic levels with electron angular momentum $Jg0$ from the hyperfine structures of nuclear spin $I=1/2$ tin isot…

spektroskopiachemistry.chemical_elementPhysics Atomic Molecular & Chemical7. Clean energy01 natural sciences010305 fluids & plasmasatomifysiikkaAtomic theory0103 physical sciencesIsotopes of tinNuclear Physics - ExperimentPhysics::Atomic Physics010306 general physicsSpectroscopyHyperfine structurePhysicsisotoopitScience & TechnologyPhysicsNuclear structureCharge (physics)OpticsConfiguration interactionchemistryPhysical SciencestinaAtomic physicsTinPhysical Review A
researchProduct

Collinear laser spectroscopy of neutron-rich cerium isotopes near theN= 88 shape transition

2003

Laser spectroscopy has been used to measure the isotope shifts of 146Ce and 148Ce relative to 144Ce, Z = 58. The new data, in combination with existing optical data on the stable isotopes and radioactive 144Ce isotope, permits a study of charge radii variations for the even-N Ce nuclei from N = 78 to N = 90. This range covers both the N = 82 shell closure and the N = 88 shape transition region. A marked increase in deformation occurs at N = 88 for elements with Z ≥ 60 but not for those with Z ≤ 56. The new data for Ce (Z = 58) show an intermediate behaviour, resulting in a smooth increase in deformation with Z in the N = 88, 90 region.

PhysicsNuclear and High Energy PhysicsRange (particle radiation)IsotopeStable isotope ratioKinetic isotope effectAnalytical chemistryNeutronDeformation (engineering)SpectroscopyCerium IsotopesJournal of Physics G: Nuclear and Particle Physics
researchProduct

Laser spectroscopy of francium isotopes at the borders of the region of reflection asymmetry

2014

The magnetic dipole moments and changes in mean-square charge radii of the neutron-rich $^{218m,219,229,231}\text{Fr}$ isotopes were measured with the newly-installed Collinear Resonance Ionization Spectroscopy (CRIS) beam line at ISOLDE, CERN, probing the $7s~^{2}S_{1/2}$ to $8p~^{2}P_{3/2}$ atomic transition. The $\delta\langle r^{2}\rangle^{A,221}$ values for $^{218m,219}\text{Fr}$ and $^{229,231}\text{Fr}$ follow the observed increasing slope of the charge radii beyond $N~=~126$. The charge radii odd-even staggering in this neutron-rich region is discussed, showing that $^{220}\text{Fr}$ has a weakly inverted odd-even staggering while $^{228}\text{Fr}$ has normal staggering. This sugges…

PhysicsNuclear and High Energy PhysicsNUCLEAR MOMENTS 218m219229231Fr; measured hyperfine spectra isotope shifts; deduced charge radii nuclear magnetic moments nuclear g factors. Comparison with available data.Isotopemedia_common.quotation_subjectFOS: Physical scienceschemistry.chemical_elementCharge (physics)[PHYS.NEXP]Physics [physics]/Nuclear Experiment [nucl-ex]nucl-exAsymmetryFranciumNuclear physicschemistryNuclear Experiment (nucl-ex)Atomic physicsGround stateSpin (physics)SpectroscopyNuclear ExperimentMagnetic dipoleRADIOACTIVITY 218mFr measured decay products Ea; deduced T1/2.media_common
researchProduct

Laser spectroscopy of neutron deficient zirconium isotopes

2002

The first optical measurements of the neutron deficient isotopes, 87-89Zr, and also the two long-lived isomers, 87m,89mZr, have been performed using the new technique of collinear laser spectroscopy of cooled, bunched ion beams. Nuclear mean-square charge radii, spins, magnetic moments and quadrupole moments spanning the N = 50 shell closure are reported. The \"kink\" in the charge radii trends at the neutron shell closure is the most pronounced obsd. for any element in the region. [on SciFinder (R)]

PhysicsNuclear and High Energy PhysicsMagnetic momentSpinsIsotopeNuclear TheoryQuadrupoleIsotopes of zirconiumNeutronAtomic physicsSpectroscopyIon
researchProduct

Charge radii, moments, and masses of mercury isotopes across the N=126 shell closure

2021

Combining laser spectroscopy in a Versatile Arc Discharge and Laser Ion Source, with Penning-trap mass spectrometry at the CERN-ISOLDE facility, this work reports on mean-square charge radii of neutron-rich mercury isotopes across the $N = 126$ shell closure, the electromagnetic moments of $^{207}$Hg and more precise mass values of $^{206-208}$Hg. The odd-even staggering (OES) of the mean square charge radii and the kink at $N = 126$ are analyzed within the framework of covariant density functional theory (CDFT), with comparisons between different functionals to investigate the dependence of the results on the underlying single-particle structure. The observed features are defined predomina…

Nuclear Theorynucl-thShell (structure)FOS: Physical sciences[PHYS.NEXP]Physics [physics]/Nuclear Experiment [nucl-ex]Mass spectrometrynucl-ex7. Clean energy01 natural sciencesNuclear Theory (nucl-th)Atomic orbital0103 physical sciencesNuclear Physics - ExperimentNuclear Experiment (nucl-ex)010306 general physicsSpectroscopyNuclear ExperimentPhysics010308 nuclear & particles physicsCharge (physics)Ion sourceddc:3. Good healthPairingNuclear Physics - TheoryDensity functional theoryAtomic physicsPräzisionsexperimente - Abteilung Blaum
researchProduct

Efficient, high-resolution resonance laser ionization spectroscopy using weak transitions to long-lived excited states

2017

Laser spectroscopic studies on minute samples of exotic radioactive nuclei require very efficient experimental techniques. In addition, high resolving powers are required to allow extraction of nu- clear structure information. Here we demonstrate that by using weak atomic transitions, resonance laser ionization spectroscopy is achieved with the required high efficiency (1-10%) and precision (linewidths of tens of MHz). We illustrate experimentally and through the use of simulations how the narrow experimental linewidths are achieved and how distorted resonance ionization spec- troscopy lineshapes can be avoided. The role of the delay of the ionization laser pulse with respect to the excitat…

Physics - Instrumentation and DetectorsFOS: Physical sciencesHigh resolution01 natural sciencesResonance (particle physics)law.inventionlawIonization0103 physical sciencesPhysics::Atomic PhysicsNuclear Experiment (nucl-ex)010306 general physicsSpectroscopyNuclear Experimentexcited statesPhysicsta114010308 nuclear & particles physicsInstrumentation and Detectors (physics.ins-det)resonance laser ionization spectroscopyLaser3. Good healthPulse (physics)exotic nucleiExcited stateAtomic physicsExcitation
researchProduct

High-resolution laser spectroscopy with the Collinear Resonance Ionisation Spectroscopy (CRIS) experiment at CERN-ISOLDE

2016

The Collinear Resonance Ionisation Spectroscopy (CRIS) experiment at CERN has achieved high-resolution resonance ionisation laser spectroscopy with a full width at half maximum linewidth of 20(1) MHz for 219;221Fr, and has measured isotopes as short lived as 5 ms with 214Fr. This development allows for greater precision in the study of hyperfine structures and isotope shifts, as well as a higher selectivity of singleisotope, even single-isomer, beams. These achievements are linked with the development of a new laser laboratory and new data-acquisition systems. publisher: Elsevier articletitle: High-resolution laser spectroscopy with the Collinear Resonance Ionisation Spectroscopy (CRIS) exp…

Nuclear and High Energy Physics[PHYS.NEXP]Physics [physics]/Nuclear Experiment [nucl-ex]7. Clean energy01 natural scienceslaw.inventionLaser linewidthlawIonization0103 physical sciencesNuclear Physics - ExperimentLaser spectroscopy010306 general physicsSpectroscopyInstrumentationHyperfine structureLarge Hadron Collider010308 nuclear & particles physicsChemistryData acquisitionResonanceLaserIon beam purificationIsotope shiftFull width at half maximumHyperfine structureAtomic physicsNuclear Instruments and Methods in Physics Research Section B: Beam Interactions with Materials and Atoms
researchProduct

Nuclear moments, charge radii and spins of the ground and isomeric states in175Yb and177Yb

2012

This paper reports static moments and changes in mean-square charge radii of 175, 177, 177mYb measured using collinear laser spectroscopy at the IGISOL facility. The moments are compared to predictions made using the Nilsson model to determine the purity of the multi-quasiparticle T1/2 = 11.4 s, Iπ = 8− state of 176Yb and the ground state of 177Yb. The ground-state spins of 175, 177Yb and the T1/2 = 6.41 s, E = 331.5 keV isomeric state in 177Yb, have been measured from the hyperfine structure to be 7/2, 9/2 and 1/2 respectively.

PhysicsNuclear and High Energy PhysicsSpinsCharge (physics)State (functional analysis)Atomic physicsSpectroscopyGround stateHyperfine structureJournal of Physics G: Nuclear and Particle Physics
researchProduct

The shape transition in the neutron-rich yttrium isotopes and isomers

2007

Abstract Laser spectroscopy has been used to study 86–90,92–102Y and isomeric states of 87–90,93,96,97,98Y. Nuclear charge radii differences, magnetic dipole and electric quadrupole moments have been obtained. Information on the nature of the Z ≈ 40 , N ≈ 60 sudden onset of deformation has been derived from all three parameters. It is seen that with increasing neutron number from the N = 50 shell closure that the nuclear deformation becomes increasingly oblate and increasingly soft. At N = 60 a transition to a strongly deformed rigid prolate shape occurs but prior to this, although the nuclear deformation is increasing with N, a proportionate increase in softness is also observed.

Nuclear physicsYttrium IsotopesPhysicsNuclear and High Energy PhysicsNeutron numberNuclear TheoryQuadrupoleCharge densityNeutronDeformation (meteorology)Magnetic dipoleMolecular physicsEffective nuclear chargePhysics Letters B
researchProduct

Analytic response relativistic coupled-cluster theory: the first application to indium isotope shifts

2019

With increasing demand for accurate calculation of isotope shifts of atomic systems for fundamental and nuclear structure research, an analytic energy derivative approach is presented in the relativistic coupled-cluster theory framework to determine the atomic field shift and mass shift factors. This approach allows the determination of expectation values of atomic operators, overcoming fundamental problems that are present in existing atomic physics methods, i.e. it satisfies the Hellmann-Feynman theorem, does not involve any non-terminating series, and is free from choice of any perturbative parameter. As a proof of concept, the developed analytic response relativistic coupled-cluster the…

CHARGE RADIIField (physics)Atomic Physics (physics.atom-ph)Physics MultidisciplinaryOther Fields of PhysicsFOS: Physical sciencesGeneral Physics and AstronomyindiumExpectation valueElectronnucl-exNMphysics.atom-ph01 natural sciencesEffective nuclear chargePhysics - Atomic Physics010305 fluids & plasmas0103 physical sciencesNuclear Physics - ExperimentNuclear Experiment (nucl-ex)010306 general physicsNuclear Experimentanalytic responsePhysicsScience & TechnologySPECTROSCOPYab initioPhysicsNuclear structureCharge (physics)specific mass shiftisotope shiftCoupled clustercoupled clusterPhysical Scienceslaser spectroscopyIONIZATIONLASERAtomic numberAtomic physicsTRANSITIONNew Journal of Physics
researchProduct

Radium ionization scheme development: The first observed autoionizing states and optical pumping effects in the hot cavity environment

2018

© 2018 The Authors This paper reports on resonance ionization scheme development for the production of exotic radium ion beams with the Resonance Ionization Laser Ion Source (RILIS) of the CERN-ISOLDE radioactive ion beam facility. During the study, autoionizing states of atomic radium were observed for the first time. Three ionization schemes were identified, originating from the 7s2 1S0 atomic ground state. The optimal of the identified ionization schemes involves five atomic transitions, four of which are induced by three resonantly tuned lasers. This is the first hot cavity RILIS ionization scheme to employ optical pumping effects. The details of the spectroscopic studies are described …

Ion beamchemistry.chemical_element[PHYS.NEXP]Physics [physics]/Nuclear Experiment [nucl-ex]01 natural sciencesAnalytical ChemistryIonlaw.inventionOptical pumpingRadiumlawIonization0103 physical sciencesPhysics::Atomic and Molecular ClustersNuclear Physics - ExperimentPhysics::Atomic Physics010306 general physicsInstrumentationSpectroscopyPhysics010308 nuclear & particles physicsLaserAtomic and Molecular Physics and OpticsIon sourcechemistryPhysics::Accelerator PhysicsAtomic physicsGround stateSpectrochimica Acta Part B: Atomic Spectroscopy
researchProduct

From Calcium to Cadmium: Testing the Pairing Functional through Charge Radii Measurements of Cd100−130

2018

Differences in mean-square nuclear charge radii of $^{100--130}\mathrm{Cd}$ are extracted from high-resolution collinear laser spectroscopy of the $5s\text{ }{^{2}S}_{1/2}\ensuremath{\rightarrow}5p\text{ }{^{2}P}_{3/2}$ transition of the ion and from the $5s5p\text{ }{^{3}P}_{2}\ensuremath{\rightarrow}5s6s\text{ }{^{3}S}_{1}$ transition in atomic Cd. The radii show a smooth parabolic behavior on top of a linear trend and a regular odd-even staggering across the almost complete $sdgh$ shell. They serve as a first test for a recently established new Fayans functional and show a remarkably good agreement in the trend as well as in the total nuclear charge radius.

Physics010308 nuclear & particles physicsGeneral Physics and AstronomyCharge (physics)Radius01 natural sciencesEffective nuclear chargeIonPairing0103 physical sciencesAtomic physics010306 general physicsSpectroscopyLinear trendPhysical Review Letters
researchProduct

Charge radii of exotic potassium isotopes challenge nuclear theory and the magic character of N = 32

2020

Nuclear charge radii are sensitive probes of different aspects of the nucleon-nucleon interaction and the bulk properties of nuclear matter; thus, they provide a stringent test and challenge for nuclear theory. The calcium region has been of particular interest, as experimental evidence has suggested a new magic number at $N = 32$ [1-3], while the unexpectedly large increases in the charge radii [4,5] open new questions about the evolution of nuclear size in neutron-rich systems. By combining the collinear resonance ionization spectroscopy method with $\beta$-decay detection, we were able to extend the charge radii measurement of potassium ($Z =19$) isotopes up to the exotic $^{52}$K ($t_{1…

kaliumNuclear Theory[PHYS.NUCL]Physics [physics]/Nuclear Theory [nucl-th]nucl-thAtomic Physics (physics.atom-ph)Nuclear TheoryOther Fields of PhysicsFOS: Physical sciencesGeneral Physics and Astronomy[PHYS.NEXP]Physics [physics]/Nuclear Experiment [nucl-ex]nucl-ex114 Physical sciencesphysics.atom-ph01 natural sciencesEffective nuclear chargePhysics - Atomic PhysicsNuclear Theory (nucl-th)Nuclear physicsCharge radius0103 physical sciencesNuclear Physics - ExperimentNeutronNuclear Experiment (nucl-ex)Nuclear Experiment010306 general physicsNuclear ExperimentPhysicsisotoopit010308 nuclear & particles physicsCharge (physics)Nuclear matter[PHYS.PHYS.PHYS-GEN-PH]Physics [physics]/Physics [physics]/General Physics [physics.gen-ph]Coupled clusterIsotopes of potassiumNuclear Physics - TheoryydinfysiikkaNuclear densityNature Physics
researchProduct

Combined high-resolution laser spectroscopy and nuclear decay spectroscopy for the study of the low-lying states inFr206,At202, andBi198

2016

High-resolution laser spectroscopy was performed on $^{206}\mathrm{Fr}$ with the collinear resonance ionization spectroscopy (CRIS) experiment at CERN-ISOLDE. The hyperfine structure and isotope shift of the ground, first isomeric and second isomeric states were measured. The hyperfine components were unambiguously assigned to each nuclear state by means of laser-assisted nuclear decay spectroscopy. The branching ratios in the $\ensuremath{\alpha}$ decay of $^{206}\mathrm{Fr}$ and $^{202}\mathrm{At}$ were also measured for the first time with isomerically purified beams. The extracted hindrance factors allow determination of the spin of the ground, first isomeric, and second isomeric states…

PhysicsIsotope010308 nuclear & particles physicsNuclear stateHigh resolutionchemistry.chemical_element01 natural sciences7. Clean energyFranciumNuclear physicschemistry0103 physical sciencesResonance ionizationPhysics::Atomic and Molecular ClustersPhysics::Atomic PhysicsAtomic physicsNuclear Experiment010306 general physicsSpectroscopyHyperfine structureRadioactive decayPhysical Review C
researchProduct

Laser spectroscopy of cooled zirconium fission fragments

2002

The first on-line laser spectroscopy of cooled fission fragments is reported. The $^{\mathrm{96}\mathrm{--}\mathrm{102}}\mathrm{Z}\mathrm{r}$ ions, produced in uranium fission, were extracted and separated using an ion guide isotope separator. The ions were cooled and bunched for collinear laser spectroscopy by a gas-filled linear Paul trap. New results for nuclear mean-square charge radii, dipole, and quadrupole moments are reported across the $N=60$ shape change. The mean-square charge radii are found to be almost identical to those of the Sr isotones and previously offered modeling of the radial changes is critically reviewed.

Materials scienceFissionGeneral Physics and AstronomyCharge densityIonDipoleNuclear magnetic resonanceQuadrupolePhysics::Atomic PhysicsIon trapAtomic physicsNuclear ExperimentSpectroscopyHyperfine structure
researchProduct

Laser spectroscopy of radioactive Ti, Zr and Hf isotopes and isomers at the JYFL laser-IGISOL facility

2003

Abstract The recent progress at the laser-ion guide isotope separator on-line facility, JYFL, is presented. At the facility new techniques for studying short-lived radioisotopes by laser spectroscopy have been developed and applied to the study of isotopes in refractory metal elements. In particular, recent results on the spectroscopy of cooled ion beams of radioactive Ti, Zr and Hf isotopes are discussed.

IsotopeChemistryRadiochemistryAnalytical chemistryRefractory metalsLaserAtomic and Molecular Physics and OpticsFluorescence spectroscopyAnalytical ChemistryIonlaw.inventionlawPhysics::Accelerator PhysicsPhysics::Atomic PhysicsNuclear ExperimentSpectroscopyInstrumentationSpectroscopySeparator (electricity)Spectrochimica Acta Part B: Atomic Spectroscopy
researchProduct

Use of a Continuous Wave Laser and Pockels Cell for Sensitive High-Resolution Collinear Resonance Ionization Spectroscopy

2015

New technical developments have led to a 2 orders of magnitude improvement of the resolution of the collinear resonance ionization spectroscopy (CRIS) experiment at ISOLDE, CERN, without sacrificing the high efficiency of the CRIS technique. Experimental linewidths of 20(1) MHz were obtained on radioactive beams of francium, allowing us for the first time to determine the electric quadrupole moment of the short lived [t1/2=22.0(5) ms]219Fr Qs=−1.21(2) eb, which would not have been possible without the advantages offered by the new method. This method relies on a continuous-wave laser and an external Pockels cell to produce narrow-band light pulses, required to reach the high resolution in t…

Physics010308 nuclear & particles physicsGeneral Physics and Astronomychemistry.chemical_element[PHYS.NEXP]Physics [physics]/Nuclear Experiment [nucl-ex]Laser7. Clean energy01 natural sciencesPockels effectFranciumIonlaw.inventionNuclear magnetic resonancechemistryOrders of magnitude (time)law0103 physical sciencesQuadrupoleContinuous waveNuclear Physics - ExperimentAtomic physics010306 general physicsSpectroscopyPhysical Review Letters
researchProduct

On the decrease in charge radii of multi-quasi particle isomers

2007

Abstract We report changes in mean-square charge radii, δ 〈 r 2 〉 , magnetic moments and quadrupole moments for three multi-quasi particle isomers; 97m2Y, 176mYb and 178m1Hf. All the isomers are observed to display a decrease in 〈 r 2 〉 compared to the lower-lying nuclear state on which the isomer is built. The decreases in 〈 r 2 〉 occur despite the isomers showing increases in quadrupole moment. Possible mechanisms for the effect, which is now seen for six multi-quasi particle isomers, are discussed.

PhysicsNuclear and High Energy PhysicsMagnetic momentNuclear stateQuadrupoleQuasiparticleCharge densityParticleCharge (physics)Atomic physicsSpectroscopyPhysics Letters B
researchProduct

Magnetic and quadrupole moments of neutron deficient 58-62Cu isotopes

2011

Abstract This paper reports on the ground state nuclear moments measured in 58–62Cu using collinear laser spectroscopy at the ISOLDE facility. The quadrupole moments for 58–60Cu have been measured for the first time as Q ( Cu 58 ) = − 15 ( 3 ) efm 2 , Q ( Cu 59 ) = − 19.3 ( 19 ) efm 2 , Q ( Cu 60 ) = + 11.6 ( 12 ) efm 2 and with higher precision for 61,62Cu as Q ( Cu 61 ) = − 21.1 ( 10 ) efm 2 , Q ( Cu 62 ) = − 2.2 ( 4 ) efm 2 . The magnetic moments of 58,59Cu are measured with a higher precision as μ ( Cu 58 ) = + 0.570 ( 2 ) μ N and μ ( Cu 59 ) = + 1.8910 ( 9 ) μ N . The experimental nuclear moments are compared to large-scale shell-model calculations with the GXPF1 and GXPF1A effective i…

PhysicsNuclear and High Energy Physicsnuclear-structureIsotopeMagnetic momentNuclear moments010308 nuclear & particles physicsshell-modelNuclear structureN=287. Clean energy01 natural sciencesShell modelCu58Cu59Cu60Cu61Cu620103 physical sciencesQuadrupoleNuclear spinNeutronHyperfine structureAtomic physicsLaser spectroscopy010306 general physicsGround stateSpectroscopyHyperfine structure
researchProduct

Collinear Resonance Ionization Spectroscopy of Neutron-Deficient Francium Isotopes

2013

The magnetic moments and isotope shifts of the neutron-deficient francium isotopes 202-205Fr were measured at ISOLDE-CERN with use of collinear resonance ionization spectroscopy. A production-to-detection efficiency of 1% was measured for 202Fr. The background from nonresonant and collisional ionization was maintained below one ion in 105 beam particles. Through a comparison of the measured charge radii with predictions from the spherical droplet model, it is concluded that the ground-state wave function remains spherical down to 205Fr, with a departure observed in 203Fr (N = 116). ispartof: Physical Review Letters vol:111 issue:21 pages:212501-4 ispartof: location:United States status: pub…

PhysicsMagnetic moment010308 nuclear & particles physicsSpin parity and isobaric spinOther Fields of PhysicsGeneral Physics and AstronomyCharge densitychemistry.chemical_element[PHYS.NEXP]Physics [physics]/Nuclear Experiment [nucl-ex]01 natural sciencesIonFranciumElectromagnetic moments190 ≤ A ≤ 219 isotpeschemistryIonization0103 physical sciencesNeutronCharge distributionPhysics::Atomic PhysicsAtomic physics010306 general physicsSpectroscopyWave functionNuclear Experiment
researchProduct

Character of an 8− isomer of 130Ba

2002

Abstract The static moments and isomer shift of the J π = K π =8 − isomeric state in 130 56 Ba have been measured using the technique of collinear laser spectroscopy. The isomer has been found to have a magnetic dipole moment of −0.043(28) μ N and a static quadrupole moment of +2.77(30) b. These values have been used to assign the state as a two neutron 7 2 + [404]⊗ 9 2 − [514] configuration corresponding to a prolate shape. The half-life of the isomer has been confirmed as 9.54(14) ms. The change in the mean square charge radius was found to be 〈 r 2 〉 130m −〈 r 2 〉 130g–s =−0.0473(30) fm 2 .

PhysicsNuclear and High Energy PhysicsNuclear magnetic resonanceCharacter (mathematics)Magnetic momentCharge radiusQuadrupoleNeutronState (functional analysis)Prolate spheroidAtomic physicsSpectroscopyPhysics Letters B
researchProduct

Erratum to ‘Simulation of the relative atomic populations of elements 1≤Z ≤89 following charge exchange tested with collinear resonance ionization sp…

2019

Materials sciencechemistryResonance ionizationchemistry.chemical_elementAtomic physicsSpectroscopyInstrumentationSpectroscopyAtomic and Molecular Physics and OpticsIndiumAnalytical ChemistryCharge exchangeSpectrochimica Acta Part B: Atomic Spectroscopy
researchProduct

High-Precision Multiphoton Ionization of Accelerated Laser-Ablated Species

2018

We demonstrate that the pulsed-time structure and high-peak ion intensity provided by the laser-ablation process can be directly combined with the high resolution, high efficiency, and low background offered by collinear resonance ionization spectroscopy. This simple, versatile, and powerful method offers new and unique opportunities for high-precision studies of atomic and molecular structures, impacting fundamental and applied physics research. We show that even for ion beams possessing a relatively large energy spread, high-resolution hyperfine-structure measurements can be achieved by correcting the observed line shapes with the time-of-flight information of the resonantly ionized ions.…

Materials science010308 nuclear & particles physicsResearchInstitutes_Networks_Beacons/photon_science_institutePhysicsQC1-999General Physics and AstronomyPhoton Science InstituteLaser7. Clean energy01 natural scienceslaw.inventionPhysics in GenerallawIonization0103 physical sciencesPhysics::Accelerator PhysicsPhysics::Atomic PhysicsAtomic physics010306 general physics
researchProduct

Collinear laser spectroscopy of radioisotopes of zirconium

2003

Isotope shifts and hyperfine structures have been measured for radioisotopes of ionic zirconium using on-line laser spectroscopy at the IGISOL facility in Jyvaskyla, where the installation of an ion beam cooler/buncher has significantly improved the experimental sensitivity. Measurements have been made on all the neutron-deficient isotopes from 87Zr to 90Zr, including the isomers 87m,89mZr, and the neutron-rich isotopes from 96Zr to 102Zr. The change in mean square charge radii between the isotopes and the nuclear moments of the odd isotopes have been extracted. The data show a sudden increase in the mean square charge radius at mass A = 100, consistent with an onset of nuclear deformation …

PhysicsNuclear and High Energy PhysicsZirconiumIon beamIsotopeIonic bondingchemistry.chemical_elementNuclear magnetic resonancechemistryCharge radiusGamma spectroscopyPhysics::Atomic PhysicsAtomic physicsNuclear ExperimentSpectroscopyHyperfine structureJournal of Physics G: Nuclear and Particle Physics
researchProduct

Development of the CRIS (Collinear Resonant Ionisation Spectroscopy) beam line

2012

The CRIS (Collinear Resonant Ionisation Spectroscopy) beam line is a new experimental set up at the ISOLDE facility at CERN. CRIS is being constructed for highresolution laser spectroscopy measurements on radioactive isotopes. These measurements can be used to extract nuclear properties of isotopes far from stability. The CRIS beam line has been under construction since 2009 and testing of its constituent parts have been performed using stable and radioactive ion beams, in preparation for its first on-line run. This paper will present the current status of the CRIS experiment and highlight results from the recent tests. ispartof: pages:012070-6 ispartof: Journal of Physics: Conference Serie…

PhysicsRadioactive ion beamsHistoryLarge Hadron ColliderNuclear structureCRIS beam line[PHYS.NEXP]Physics [physics]/Nuclear Experiment [nucl-ex]7. Clean energy01 natural sciences010305 fluids & plasmasComputer Science ApplicationsEducationNuclear physicsBeamlineIonization0103 physical sciencesPhysics::Accelerator PhysicsCollinear resonant ionisation spectroscopyAtomic physicsNuclear Experiment010306 general physicsSpectroscopyComputingMilieux_MISCELLANEOUS
researchProduct

In-source laser spectroscopy of75,77,78Cu: Direct evidence for a change in the quasiparticle energy sequence in75,77Cu and an absence of longer-lived…

2011

This paper describes measurements on the isotopes (75,77,78)Cu by the technique of in-source laser spectroscopy, at the ISOLDE facility, CERN. The role of this technique is briefly discussed in the ...

PhysicsMass numberNuclear and High Energy PhysicsQuantitative Biology::Neurons and CognitionIsotopeMagnetic momentIsotopes of copperStable isotope ratioIsotope separationlaw.inventionlawQuasiparticlePhysics::Accelerator PhysicsPhysics::Atomic PhysicsAtomic physicsNuclear ExperimentSpectroscopyPhysical Review C
researchProduct

Spectroscopy of short-lived radioactive molecules

2020

Molecular spectroscopy offers opportunities for the exploration of the fundamental laws of nature and the search for new particle physics beyond the standard model1–4. Radioactive molecules—in which one or more of the atoms possesses a radioactive nucleus—can contain heavy and deformed nuclei, offering high sensitivity for investigating parity- and time-reversal-violation effects5,6. Radium monofluoride, RaF, is of particular interest because it is predicted to have an electronic structure appropriate for laser cooling6, thus paving the way for its use in high-precision spectroscopic studies. Furthermore, the effects of symmetry-violating nuclear moments are strongly enhanced5,7–9 in molecu…

spektroskopiacollinearnucl-ex01 natural sciences010305 fluids & plasmasRadiumchemistry.chemical_compoundIonizationExperimental nuclear physicsNuclear ExperimentPhysicsMultidisciplinaryLarge Hadron ColliderStable isotope rationew physics[PHYS.HTHE]Physics [physics]/High Energy Physics - Theory [hep-th]hep-thmolekyylithep-phradiumelectron: electric momentNuclear Physics - Theoryradioactivitymany-body problemElectronic structure of atoms and moleculesAtomic physicsydinfysiikkaParticle Physics - Theoryexceptionalnucl-th[PHYS.NUCL]Physics [physics]/Nuclear Theory [nucl-th]MonofluorideResearchInstitutes_Networks_Beacons/photon_science_institutechemistry.chemical_elementnucleus: structure functionElectronic structure[PHYS.NEXP]Physics [physics]/Nuclear Experiment [nucl-ex]Photon Science InstituteArticle0103 physical sciencesionizationMoleculeNuclear Physics - Experiment010306 general physicsSpectroscopyenhancementParticle Physics - Phenomenologystabilitysensitivitylaserchemistry[PHYS.HPHE]Physics [physics]/High Energy Physics - Phenomenology [hep-ph]Exotic atoms and moleculesnucleus: deformation
researchProduct

Nuclear charge radii of neutron deficient titanium isotopes44Ti and45Ti

2004

Optical isotope shifts of the unstable 44,45Ti isotopes, as well as those of stable 46−50Ti, have been investigated by collinear laser spectroscopy on fast ion beams using an ion guide isotope separator with a cooler-buncher. Changes in mean square charge radii across the neutron 1f7/2 shell are deduced. The evolution of the even-N Ti nuclear radii shows a generally increasing tendency with decreasing neutron number. This behaviour is significantly different to that of the neighbouring Ca isotopes which exhibit a symmetric parabolic behaviour across the shell. The trend of the Ti nuclear radii is consistent with the predictions of the relativistic mean-field theory. The charge radius of 44T…

PhysicsNuclear and High Energy PhysicsIsotopeMean field theoryCharge radiusNeutron numberNuclear TheoryNeutronAtomic physicsNuclear ExperimentSpectroscopyEffective nuclear chargeIonJournal of Physics G: Nuclear and Particle Physics
researchProduct

Isotope Shifts of Radium Monofluoride Molecules

2021

Isotope shifts of $^{223-226,228}$Ra$^{19}$F were measured for different vibrational levels in the electronic transition $A^{2}{}{\Pi}_{1/2}\leftarrow X^{2}{}{\Sigma}^{+}$. The observed isotope shifts demonstrate the particularly high sensitivity of radium monofluoride to nuclear size effects, offering a stringent test of models describing the electronic density within the radium nucleus. Ab initio quantum chemical calculations are in excellent agreement with experimental observations. These results highlight some of the unique opportunities that short-lived molecules could offer in nuclear structure and in fundamental symmetry studies.

[PHYS.NUCL] Physics [physics]/Nuclear Theory [nucl-th]FIELD SHIFTNuclear TheoryAtomic Physics (physics.atom-ph)Ab initioGeneral Physics and AstronomyNUCLEAR-STRUCTUREnucl-ex01 natural sciencesPhysics - Atomic Physics010305 fluids & plasmasENERGYchemistry.chemical_compoundatomifysiikkaMOMENTSPhysics::Atomic PhysicsNuclear Experiment (nucl-ex)Nuclear ExperimentNuclear ExperimentPhysicsIsotopePhysicsNuclear structureradiumNuclear Physics - TheoryPhysical SciencesAtomic physicsydinfysiikkanucl-th[PHYS.NUCL]Physics [physics]/Nuclear Theory [nucl-th]Monofluoride[PHYS.NEXP] Physics [physics]/Nuclear Experiment [nucl-ex][PHYS.PHYS.PHYS-GEN-PH] Physics [physics]/Physics [physics]/General Physics [physics.gen-ph]Physics MultidisciplinaryOther Fields of PhysicsFOS: Physical sciences[PHYS.NEXP]Physics [physics]/Nuclear Experiment [nucl-ex]physics.atom-phMolecular electronic transitionELECTRONIC-STRUCTURE CALCULATIONSNuclear Theory (nucl-th)ATOMS0103 physical sciencesMoleculeSPECTRANuclear Physics - ExperimentSensitivity (control systems)010306 general physicsisotoopitScience & Technology[PHYS.PHYS.PHYS-GEN-PH]Physics [physics]/Physics [physics]/General Physics [physics.gen-ph]chemistryMECHANICSMASS DEPENDENCELASERElectronic density
researchProduct

Experimental determination of anIπ=2−ground state inCu72,74

2010

This article reports on the ground-state spin and moments measured in $^{72,74}\mathrm{Cu}$ using collinear laser spectroscopy at the CERN On-Line Isotope Mass Separator (ISOLDE) facility. From the measured hyperfine coefficients, the nuclear observables $\ensuremath{\mu}$(${}^{72}\mathrm{Cu})=\ensuremath{-}1.3472(10){\ensuremath{\mu}}_{N}$, $\ensuremath{\mu}({}^{74}\mathrm{Cu})=\ensuremath{-}1.068(3){\ensuremath{\mu}}_{N}$, $Q({}^{72}\mathrm{Cu})=+8(2) {\mathrm{efm}}^{2}$, $Q({}^{74}\mathrm{Cu})=+26(3) {\mathrm{efm}}^{2}$, $I({}^{72}\mathrm{Cu})=2$, and $I({}^{74}\mathrm{Cu})=2$ have been determined. Through a comparison of the measured magnetic moments with different models, the negative …

PhysicsNuclear and High Energy PhysicsParticle propertiesQuantitative Biology::Neurons and CognitionMagnetic moment010308 nuclear & particles physicsIsotopes of copper01 natural sciences0103 physical sciencesAtomic physics010306 general physicsSpectroscopyWave functionGround stateHyperfine structurePhysical Review C
researchProduct

Optimising the Collinear Resonance Ionisation Spectroscopy (CRIS) experiment at CERN-ISOLDE

2020

© 2019 The CRIS experiment at CERN-ISOLDE is a dedicated laser spectroscopy setup for high-resolution hyperfine structure measurements of nuclear observables of exotic isotopes. Between 2015 and 2018 developments have been made to improve the background suppression, laser-atom overlap and automation of the beamline. Furthermore, a new ion source setup has been developed for offline studies. Here we present the latest technical developments and future perspectives for the experiment. ispartof: Nuclear Instruments & Methods In Physics Research Section B-Beam Interactions With Materials And Atoms vol:463 pages:384-389 ispartof: location:SWITZERLAND, CERN, Geneva status: published

Nuclear and High Energy Physicshyperfine structuretutkimuslaitteetspektroskopiaCERN-ISOLDEhigh-resolution7. Clean energy01 natural sciencesNuclear physicsCRISIonization0103 physical sciencesDalton Nuclear InstitutePhysics::Atomic PhysicsNuclear Experiment010306 general physicsSpectroscopyInstrumentationHyperfine structurePhysicsLarge Hadron Collider010308 nuclear & particles physicsResonanceIon sourceResearchInstitutes_Networks_Beacons/dalton_nuclear_instituteBeamlineBackground suppressionlaser spectroscopycollinear resonance ionization spectroscopyPhysics::Accelerator PhysicsydinfysiikkaNuclear Instruments and Methods in Physics Research Section B: Beam Interactions with Materials and Atoms
researchProduct

Discovery of a long-lived low-lying isomeric state in Ga-80

2010

Collinear laser spectroscopy was performed on the $^{80}\mathrm{Ga}$ isotope at ISOLDE, CERN. A low-lying isomeric state with a half-life much greater than $200$ ms was discovered. The nuclear spins and moments of the ground and isomeric states and the isomer shift are discussed. Probable spins and parities are assigned to both long-lived states (${3}^{\ensuremath{-}}$ and ${6}^{\ensuremath{-}}$) deduced from a comparison of the measured moments to shell-model calculations.

PhysicsNuclear and High Energy PhysicsParticle propertiesSpinsIsotope010308 nuclear & particles physicsParity (physics)[PHYS.NEXP]Physics [physics]/Nuclear Experiment [nucl-ex]7. Clean energy01 natural sciencesQUADRUPOLE-MOMENTSIsomeric shift0103 physical sciencesPhysics::Atomic and Molecular ClustersNuclear Physics - ExperimentAtomic physics010306 general physicsSpectroscopyNuclear Experiment
researchProduct

Cu charge radii reveal a weak sub-shell effect at N=40

2016

Collinear laser spectroscopy on Cu58-75 isotopes was performed at the CERN-ISOLDE radioactive ion beam facility. In this paper we report on the isotope shifts obtained from these measurements. State-of-the-art atomic physics calculations have been undertaken in order to determine the changes in mean-square charge radii δ(r2)A,A′ from the observed isotope shifts. A local minimum is observed in these radii differences at N=40, providing evidence for a weak N=40 sub-shell effect. However, comparison of δ(r2)A,A′ with a droplet model prediction including static deformation deduced from the spectroscopic quadrupole moments, points to the persistence of correlations at N=40.

PhysicsIon beamIsotope010308 nuclear & particles physicsModel predictionShell (structure)Charge (physics)[PHYS.NEXP]Physics [physics]/Nuclear Experiment [nucl-ex]01 natural sciencesPhysique atomique et nucléaire0103 physical sciencesQuadrupolePhysics::Accelerator PhysicsPhysics::Atomic PhysicsPräzisionsexperimente - Abteilung BlaumAtomic physicsDeformation (engineering)010306 general physicsSpectroscopyNuclear Experiment
researchProduct

Laser assisted decay spectroscopy at the CRIS beam line at ISOLDE

2012

A new collinear resonant ionization spectroscopy (Cris)beam line has recently been installed at Isolde, Cern utilising lasers to combine collinear laser spectroscopy and resonant ionization spectroscopy. The combined technique offers the ability to purify an ion beam that is heavily contaminated with radioactive isobars, including the ground state of an isotope from its isomer, allowing sensitive secondary experiments to be performed. A new programme aiming to use the Cris technique for the separation of nuclear isomeric states for decay spectroscopy will commence in 2011. A decay spectroscopy station, consisting of a rotating wheel implantation system for alpha decay spectroscopy, and thre…

laser assisted decay spectroscopyHistoryIon beamCRIS beam line[PHYS.NEXP]Physics [physics]/Nuclear Experiment [nucl-ex]01 natural sciences7. Clean energyParticle detector010305 fluids & plasmasEducationlaw.inventionlawIonization0103 physical sciencesNuclear Experiment010306 general physicsSpectroscopyComputingMilieux_MISCELLANEOUSChemistryLaserComputer Science ApplicationsSemiconductor detectorcollinear resonant ionization spectroscopyPhysics::Accelerator PhysicsHigh Energy Physics::ExperimentAlpha decayAtomic physicsRadioactive decay
researchProduct

Nuclear spins, magnetic moments, and quadrupole moments of Cu isotopes fromN=28toN=46: Probes for core polarization effects

2010

Measurements of the ground-state nuclear spins and magnetic and quadrupole moments of the copper isotopes from $^{61}\mathrm{Cu}$ up to $^{75}\mathrm{Cu}$ are reported. The experiments were performed at the CERN online isotope mass separator (ISOLDE) facility, using the technique of collinear laser spectroscopy. The trend in the magnetic moments between the $N=28$ and $N=50$ shell closures is reasonably reproduced by large-scale shell-model calculations starting from a $^{56}\mathrm{Ni}$ core. The quadrupole moments reveal a strong polarization of the underlying Ni core when the neutron shell is opened, which is, however, strongly reduced at $N=40$ due to the parity change between the $\mat…

PhysicsNuclear and High Energy PhysicsSpinsMagnetic moment010308 nuclear & particles physicsIsotopes of copperNuclear TheoryHadron01 natural sciences7. Clean energyBaryon0103 physical sciencesQuadrupoleNeutronAtomic physics010306 general physicsNucleonPhysical Review C
researchProduct

Simulation of the relative atomic populations of elements 1 ≤ Z ≤89 following charge exchange tested with collinear resonance ionization spectroscopy…

2019

© 2019 The Authors Calculations of the neutralisation cross-section and relative population of atomic states were performed for ions beams (1 ≤ Z ≤ 89) at 5 and 40 keV incident on free sodium and potassium atoms. To test the validity of the calculations, the population distribution of indium ions incident on a vapour of sodium was measured at an intermediate energy of 20 keV. The relative populations of the 5s 2 5p 2 P 1/2 and 5s 2 5p 2 P 3/2 states in indium were measured using collinear resonance ionization spectroscopy and found to be consistent with the calculations. Charge exchange contributions to high-resolution lineshapes were also investigated and found to be reproduced by the calc…

Materials sciencekaliumElectron captureSodiumPotassiumPopulationspektroskopiachemistry.chemical_elementindium01 natural sciencesAnalytical ChemistryIonatomifysiikkaPhysics in General0103 physical sciencesPhysics::Atomic Physicselectron capturenatrium010306 general physicseducationSpectroscopyInstrumentationsodiumSpectroscopyeducation.field_of_studyatomic populationsIsotopeta114010308 nuclear & particles physicspotassiumcharge exchangeAtomic and Molecular Physics and Opticssemi-classical impact parameterchemistrylaser spectroscopycollinear resonance ionization spectroscopyAtomic physicsIndiumSpectrochimica Acta Part B: Atomic Spectroscopy
researchProduct

Structure of191Pb from α- and β-decay spectroscopy

2010

International audience; Complementary studies of 191 Pb have been made in the β decay of 191 Bi at LISOL (CRC) and in the α decay of 195 Po at ISOLDE (CERN). Fine structures in the α decay of the low-spin and high-spin isomers of 195 Po have been fully resolved. Identification of the parent state is made possible via isomer selection based on narrowband laser frequency scanning. The α-particle and γ-ray energies have been determined with greater precision. New α-particle and γ-ray energies are identified. Branching ratios in the decay of 195 Po and 191 Pb have been examined. Structure of 191 Pb from α- and β-decay spectroscopy 2 PACS numbers: 23.20.Nx Internal conversion, 23.60.+e α decay, …

PhysicsNuclear and High Energy PhysicsLarge Hadron Collider010308 nuclear & particles physicsBranching fractionAlpha particle01 natural sciencesBeta decayNuclear physicsPhysical Sciences0103 physical sciencesPhysics::Accelerator PhysicsHigh Energy Physics::ExperimentAlpha decayAtomic physicsNuclear Experiment010306 general physicsSpectroscopyJournal of Physics G: Nuclear and Particle Physics
researchProduct

First application of the Laser Ion Source and Trap (LIST) for on-line experiments at ISOLDE

2012

The Laser Ion Source and Trap (LIST) provides a new mode of operation for the resonance ionization laser ion source (RILIS) at ISOLDE/CERN, reducing the amount of surface-ionized isobaric contaminants by up to four orders of magnitude. After the first successful on-line test at ISOLDE in 2011 the LIST was further improved in terms of efficiency, selectivity, and reliability through several off-line tests at Mainz University and at ISOLDE. In September 2012, the first on-line physics experiments to use the LIST took place at ISOLDE. The measurements of the improved LIST indicate more than a twofold increase in efficiency compared to the LIST of the 2011 run. The suppression of surface-ionize…

Nuclear and High Energy Physics[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Ion trapchemistry.chemical_element01 natural sciencesIn-source laser spectroscopylaw.inventionFranciumTrap (computing)LISTlawIonization0103 physical sciences010306 general physicsInstrumentationLaser ion sourceLarge Hadron Collider[PHYS.PHYS.PHYS-ATOM-PH]Physics [physics]/Physics [physics]/Atomic Physics [physics.atom-ph]010308 nuclear & particles physicsChemistryOn-line mass separatorOrders of magnitude (angular velocity)LaserIon sourceIon trapAtomic physics
researchProduct

Characterization of the shape-staggering effect in mercury nuclei

2018

In rare cases, the removal of a single proton (Z) or neutron (N) from an atomic nucleus leads to a dramatic shape change. These instances are crucial for understanding the components of the nuclear interactions that drive deformation. The mercury isotopes (Z = 80) are a striking example1,2: their close neighbours, the lead isotopes (Z = 82), are spherical and steadily shrink with decreasing N. The even-mass (A = N + Z) mercury isotopes follow this trend. The odd-mass mercury isotopes 181,183,185Hg, however, exhibit noticeably larger charge radii. Due to the experimental difficulties of probing extremely neutron-deficient systems, and the computational complexity of modelling such heavy nucl…

Quantum phase transitionPhysicsIsotope010308 nuclear & particles physicsNuclear TheoryGeneral Physics and Astronomy[PHYS.NEXP]Physics [physics]/Nuclear Experiment [nucl-ex]01 natural sciences3100Atomic orbital13. Climate action0103 physical sciencesAtomic nucleusQuadrupoleNuclear Physics - ExperimentNeutronNuclidePräzisionsexperimente - Abteilung BlaumAtomic physics010306 general physicsSpectroscopyNuclear Experiment
researchProduct

Charge radii of odd-A 191–211Po isotopes

2013

Isotope shifts have been measured for the odd-A polonium isotopes 191–211Po and changes in the nuclear mean square charge radii δr2 have been deduced. The measurements were performed at CERN-ISOLDE using the in-source resonance-ionization spectroscopy technique. The combined analysis of these data and our recent results for even-A polonium isotopes indicates an onset of deformation already at 197,198Po, when going away from stability. This is significantly earlier than was suggested by previous theoretical and experimental studies of the polonium isotopes. Moreover and in contrast to the mercury isotopes, where a strong odd–even staggering of the charge radii of the ground states was observ…

PhysicsMean squareNuclear and High Energy PhysicsIsotope010308 nuclear & particles physicsShape coexistencechemistry.chemical_elementMercury IsotopesCharge (physics)[PHYS.NEXP]Physics [physics]/Nuclear Experiment [nucl-ex]01 natural sciencesIsotopes of nitrogenNuclear physicsIsotope shiftchemistry0103 physical sciencesNeutronPhysics::Atomic PhysicsAtomic physicsNuclear charge radiusNuclear Experiment010306 general physicsSpectroscopyPoloniumPhysics Letters B
researchProduct

Laser spectroscopy of gallium isotopes beyond N = 50

2012

The installation of an ion-beam cooler-buncher at the ISOLDE, CERN facility has provided increased sensitivity for collinear laser spectroscopy experiments. A migration of single-particle states in gallium and in copper isotopes has been investigated through extensive measurements of ground state and isomeric state hyperfine structures. Lying beyond the N = 50 shell closure, 82Ga is the most exotic nucleus in the region to have been studied by optical methods, and is reported here for the first time. ispartof: pages:012071-6 ispartof: Journal of Physics: Conference Series vol:381 issue:1 pages:012071-6 ispartof: Rutherford Centennial Conference on Nuclear Physics location:Manchester, UK dat…

HistoryHyperfine structure of gallium isotopesIsotopes of copperCollinear laser spectroscopychemistry.chemical_elementMagnetic and quadrupole moments of gallium isotopeskiihdytinpohjainen fysiikkaEducationydinrakenneGalliumSpectroscopyNuclear ExperimentHyperfine structurenuclear spectroscopyIsotopeaccelerator-based physicsNuclear structureComputer Science ApplicationsCOLLAPS beam lineIsotopes of galliumchemistrynuclear structureydinspektroskopiaPhysics::Accelerator PhysicsAtomic physicsGround stateydinfysiikka
researchProduct

Collinear laser spectroscopy of ZrII

2003

A new technique involving collinear laser spectroscopy of ion bunches has been used to study the radio-isotopes 87,87m,88,89,89m Zr.

X-ray laserMaterials scienceFar-infrared laserUltrafast laser spectroscopyLaser-induced breakdown spectroscopyTime-resolved spectroscopyAtomic physicsSpectroscopyCoherent spectroscopyIon
researchProduct

Collinear laser spectroscopy at ISOLDE: new methods and highlights

2017

Over three and a half decades of collinear laser spectroscopy and the COLLAPS setup have played a major role in the ISOLDE physics programme. Based on a general experimental principle and diverse approaches towards higher sensitivity, it has provided unique access to basic nuclear properties such as spins, magnetic moments and electric quadrupole moments as well as isotopic variations of nuclear mean square charge radii. While previous methods of outstanding sensitivity were restricted to selected chemical elements with special atomic properties or nuclear decay modes, recent developments have yielded a breakthrough in sensitivity for nuclides in wide mass ranges. These developments include…

Physicsnuclear moments and radiiNuclear and High Energy PhysicsSpinsMagnetic momentIsotope010308 nuclear & particles physics[PHYS.NEXP]Physics [physics]/Nuclear Experiment [nucl-ex]7. Clean energy01 natural sciencesNuclear physicsexotic isotopesOrders of magnitude (time)0103 physical sciencesQuadrupolelaser spectroscopyPhysics::Atomic PhysicsNuclide[PHYS.PHYS.PHYS-INS-DET]Physics [physics]/Physics [physics]/Instrumentation and Detectors [physics.ins-det]Präzisionsexperimente - Abteilung Blaum010306 general physicsSpectroscopyNuclear ExperimentRadioactive decay
researchProduct

Nuclear mean-square charge radii of $^{63,64,66,68−82}$Ga nuclei: No anomalous behavior at N=32

2012

Collinear laser spectroscopy was performed on the 63,64,66,68−82Ga isotopes with neutron numbers from N = 32 to N = 51. These measurements were carried out at the ISOLDE radioactive ion beam facility at CERN. Here we present the nuclear mean-square charge radii extracted from the isotope shifts and, for the lighter isotopes, new spin and moment values. New ground-state nuclear spin and moments were extracted from the hyperfine spectra of 63,70Ga, measured on an atomic transition in the neutral atom. The ground-state spin of 63Ga is determined to be I = 3/2. Analysis of the trend in the change in mean-square charge radii of the gallium isotopes demonstrates that there is no evidence of anoma…

nuclear spectroscopyydinrakenneaccelerator-based physicsnuclear structureydinspektroskopiaddc:530Physics::Atomic PhysicsNuclear Experimentydinfysiikkakiihdytinpohjainen fysiikka
researchProduct