Search results for " Effectivenes"

showing 10 items of 265 documents

Consumption behavior of eco-friendly products and applications of ICT innovation

2021

The purchase of eco-friendly products is encouraged by the governments due to its contributions to the sustainable development of the environment. It is therefore important to examine factors influencing the purchase of eco-friendly products. Based on the attitude-behavior-context (ABC) theory, this paper constructs a conceptual model, which explores how a consumer’s perceived effectiveness affects individuals’ purchase of eco-friendly products. In details, this paper attempts to examine the mediating role of consumption attitude of eco-friendly products, as well as the moderating effect of applications of information and communication technologies (ICT) innovation. Moreover, by building a …

kestävä kulutusperceived effectivenessconsumer attitudeICTkulutustottumuksettieto- ja viestintätekniikkaeco-friendly productkuluttajakäyttäytyminensustainabilityympäristöystävälliset tuotteetconsumption behavior
researchProduct

Antecedents of daily team job crafting

2017

This study investigated potential antecedents of team job crafting defined as the extent to which team members engage together in increasing (social and structural) job resources and challenges, and decreasing hindering job demands. Mindful of the teamwork literature, we hypothesized that individual employee factors (self-efficacy for teamwork, daily affect), team features (team cohesion, climate) and the organizational context of teams (engaging leadership and organizational resources for teamwork) relate positively to daily team job crafting behaviour. Data were collected among 46 multi-professional rehabilitation teams whose members completed two daily surveys after their weekly meetings…

leadershipOrganizational Behavior and Human Resource Managementmedia_common.quotation_subjectApplied psychologyPsychological interventionTeam effectiveness050109 social psychologyPsychological safetyAffect (psychology)teamsJob craftingproactive behaviour0502 economics and businessTaverne0501 psychology and cognitive sciencesJob craftingta515Applied Psychologymedia_commonTeam compositionTeamworkComputingMilieux_THECOMPUTINGPROFESSION05 social sciencesCohesion (linguistics)antecedentsPsychologySocial psychology050203 business & management
researchProduct

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct

“Thanks for Watching.” The Effectiveness of YouTube vlogendorsements

2019

This study examines the effectiveness of brand endorsements in vlogs (video blogs) by assessing the role of audience participation, parasocial relationship, and valence toward vlog endorsements on the perceived credibility of the vlogger and brand attitudes. Four experimental conditions were created on Qualtrics based on a YouTube vlog where the endorser reviewed a few products. The data were collected using Mturk and analyzed with 203 usable responses. The findings indicate that audience participation in the vlog enhances para-social relationship with the vlogger, thus further fostering the vlogger's perceived credibility as an endorser. Additionally, the valence of the audience's attitude…

media_common.quotation_subject050801 communication & media studiesendorser credibilityendorsement effectivenessyleisö0508 media and communicationsArts and Humanities (miscellaneous)PerceptionaudienceCredibilityparticipationValence (psychology)ta518vlogitvalenceAudience participationta512General Psychologyvlogmedia_commonosallistuminen05 social sciences050301 educationPerceived credibilityOnline communityaudience participationvloggausHuman-Computer Interactionvalenssi (psykologia)Psychology0503 educationSocial psychologyparasocial relationship
researchProduct

State Sovereignty: Balancing Effectiveness and Legality/Legitimacy

2018

This chapter aims to examine one of the most interesting topics in the contemporary internationalist debate, namely the crisis of effectiveness as the ultimate or sufficient criterion for achieving statehood and territorial sovereignty. Since the 1970s the perception that international law can no longer accept social reality as it is but promotes and imposes standards of justice and common values has become increasingly widespread. More recently, the ensuing discussion between realists and legalists emerged as one of the central topics addressed within the framework of the advisory procedure concerning Kosovo’s declaration of independence. By discussing and critically appraising the normati…

media_common.quotation_subjectlegitimacyPrinciple of legalitylegalityEconomic Justice[SHS]Humanities and Social SciencesState (polity)SecessionSovereigntyDeclaration of independencePolitical science050602 political science & public administrationstatehood effectiveness legality legitimacy non-recognition secessionSettore IUS/13 - Diritto InternazionaleLegitimacyComputingMilieux_MISCELLANEOUS0505 lawmedia_commonLaw and economics050502 lawnon-recognition05 social sciencesInternational lawstatehood16. Peace & justice0506 political scienceeffectivenesecession
researchProduct

The development of teachers’ responses to challenging situations during interaction training

2014

The qualitative changes in teachers’ responses in challenging situations were analysed during a four-day Teacher Effectiveness Training (TET) course, which aimed at improving teachers’ interpersonal dynamics with pupils, parents and colleagues. The participants were 21 teachers from one elementary and 23 teachers from one secondary school attending a TET course in Finland. Qualitative abductive content analysis was used to classify the data. Frequencies based on this analysis were also looked at. After TET the teachers described the behaviour of their pupils and expressed their feelings and the actual consequences of that behaviour, instead of using generalized labels and subjective interpr…

media_common.quotation_subjectsupporting autonomyInterpersonal communicationteacher trainingEducationPedagogyAgency (sociology)Mathematics educationta5160501 psychology and cognitive sciencesActive listeningta515media_common4. Education05 social sciencesSocial change050301 educationsocial and emotional learningteacher effectiveness trainingFeelingContent analysisSELPsychology0503 educationAutonomy050104 developmental & child psychologyQualitative researchTeacher Development
researchProduct

COVID-19 and diabetes management: What should be considered?

2020

medicine.medical_specialty2019-20 coronavirus outbreakCoronavirus disease 2019 (COVID-19)Clinical effectivenessbusiness.industryEndocrinology Diabetes and MetabolismSevere acute respiratory syndrome coronavirus 2 (SARS-CoV-2)Cardiovascular disease COVID-19 Diabetes DPP4 GLP-1RA Hydroxychloroquine Pioglitazone SGLT-2General Medicinemedicine.diseaseEndocrinologyDiabetes managementDiabetes mellitusInternal MedicinemedicineSodium-Glucose Cotransporter 2 InhibitorIntensive care medicinebusinessPioglitazonemedicine.drugDiabetes research and clinical practice
researchProduct

Cost Effectiveness of Peginterferon ??-2a Plus Ribavirin versus Interferon ??-2b Plus Ribavirin as Initial Therapy for Treatment-Naive Chronic Hepati…

2004

Introduction: In adults with previously untreated chronic hepatitis C (CHC), the combination of peginterferon α-2a plus ribavirin produces a higher rate of sustained virological response (SVR) than interferon α-2b plus ribavirin, but it is still unproven whether this increase is cost effective. The objective of this study was to determine if the gain in SVR with peginterferon α-2a plus ribavirin is worth the incremental cost. Methods: We constructed a Markov model of disease progression in which cohorts of patients received peginterferon α-2a plus ribavirin or interferon α-2b plus ribavirin for 48 weeks (hepatitis C virus [HCV] genotype 1 and non-1 patients with fibrosis) or 24 weeks (genot…

medicine.medical_specialtyCirrhosisGenotypeCost effectivenessCost-Benefit AnalysisHepatitis C virusInterferon alpha-2medicine.disease_causeAntiviral AgentsSensitivity and SpecificityGastroenterologypeginterferon alpha2aPolyethylene Glycolschemistry.chemical_compoundchronic hepatitiInterferonInternal medicineRibavirinmedicineHumansRandomized Controlled Trials as Topicalpha2b interferonAntiviral AgentPharmacologybusiness.industryHealth PolicyRibavirinPublic Health Environmental and Occupational HealthInterferon-alphavirus diseasesHealth Care CostsHepatitis CHepatitis C Chronicmedicine.diseaseMarkov ChainsRecombinant Proteinsdigestive system diseasesModels EconomicTreatment OutcomechemistryImmunologyQuality of LifePeginterferon alfa-2bDrug Therapy CombinationbusinessPeginterferon alfa-2amedicine.drugPharmacoEconomics
researchProduct

Cost-effectiveness of sofosbuvir-based triple therapy for untreated patients with genotype 1 chronic hepatitis C

2014

We assessed the cost-effectiveness of sofosbuvir (SOF)-based triple therapy (TT) compared with boceprevir (BOC)- and telaprevir (TVR)-based TT in untreated genotype 1 (G1) chronic hepatitis C (CHC) patients discriminated according to IL28B genotype, severity of liver fibrosis, and G1 subtype. The available published literature provided the data source. The target population was made up of untreated Caucasian patients, aged 50 years, with G1CHC and these were evaluated over a lifetime horizon by Markov model. The study was carried out from the perspective of the Italian National Health Service. Outcomes included discounted costs (in euros at 2013 value), life-years gained (LYG), quality-adju…

medicine.medical_specialtyCirrhosisHepatologySofosbuvirCost effectivenessbusiness.industryHepatologymedicine.diseaseSurgeryQuality-adjusted life yearTelaprevirchemistry.chemical_compoundTolerabilitychemistryBoceprevirInternal medicinemedicinebusinesshealth care economics and organizationsmedicine.drugHepatology
researchProduct

Cost-effectiveness of screening for colorectal cancer in France using a guaiac test versus an immunochemical test

2010

Objectives: The aim of this study was to compare the cost and the effectiveness of two biennial fecal occult blood screening tests for colorectal cancer: a guaiac nonrehydrated test (G-FOBT) and an immunochemical test (I-FOBT) with the absence of screening.Methods: A Markov model was developed to compare these strategies in a general population of subjects aged 50 to 74 over a 20-year period.Results: Compared with the absence of screening, G-FOBT and I-FOBT were associated with a decrease in colorectal cancer mortality of 17.4 percent and 25.2 percent, respectively. With regard to cost-effectiveness, expressed as cost per life-year gained, I-FOBT was the most effective and most costly alter…

medicine.medical_specialtyColorectal cancerCost effectivenessCost-Benefit Analysishealth care facilities manpower and serviceseducationPopulationImmunologic TestsSensitivity and SpecificityInternal medicinemedicineHumansMass ScreeningeducationSensitivity analyseshealth care economics and organizationsMass screeningAgedGynecologyeducation.field_of_studybiologybusiness.industryHealth PolicyEurosMiddle Agedmedicine.diseasebiology.organism_classificationMarkov Chainsdigestive system diseasesTest (assessment)surgical procedures operativeFecal occult blood screeningOccult BloodIndicators and ReagentsFranceColorectal NeoplasmsGuaiacbusinessInternational Journal of Technology Assessment in Health Care
researchProduct