Search results for " effect"

showing 10 items of 7524 documents

Penyagolosa Trails: From Ancestral Roads to Sustainable Ultra-Trail Race, between Spirituality, Nature, and Sports. A Case of Study

2019

[EN] The organization of an open-air sporting event involves a series of challenges. People are drawn by the desire to do sport, preferably in close contact with nature, so as to complement healthy lifestyles, and in search of air purity. Sporting organizations are increasingly searching for new locations that do not only attract athletes, but spectators and companions too. Races in natural parks provide the additional benefit of doing sport in a unique space, usually a transmitter of simplicity, pure air, and tranquillity. Organizing a mountain race in a natural park implies some issues. These are areas of great environmental richness that must be protected. Natural parks are places of ind…

lcsh:TJ807-830Sustainable tourismRural tourismGeography Planning and Developmentlcsh:Renewable energy sourcesNatural parkHeritageSports tourism010501 environmental sciencesManagement Monitoring Policy and Law01 natural sciencesRace (biology)0502 economics and businessRecreationlcsh:Environmental sciencesSustainable tourism0105 earth and related environmental scienceslcsh:GE1-350EsportsPilgrimageRenewable Energy Sustainability and the Environmentlcsh:Environmental effects of industries and plants05 social sciencesEnvironmental ethicsReligious tourismPilgrimagelcsh:TD194-195GeographyTranquillitySustainabilityORGANIZACION DE EMPRESAS050212 sport leisure & tourismSports tourismSustainability
researchProduct

Softening of Silica Filled Styrene-Butadiene Rubber under Uniaxial Cyclic Loading

2016

Stress-strain behaviour of silica filled styrene-butadiene rubber showed strong hysteresis and cyclic softening, while these effects were almost negligible for the neat rubber. Significant Mullins effect occurs between the first and second loading cycles, whereupon samples reach their steady state after four repeated cycles. The degree of softening increases with volume content of silica characterizing the softening effect as a breakdown of the filler-formed microstructure defined by both, specific interactions in the filler associations and between the filler and rubber matrix. Contribution of different damage mechanisms to the total energy losses on different stages of extension was estim…

lcsh:TN1-997Materials scienceStyrene-butadiene02 engineering and technologystress softeningcomplex mixturesStress (mechanics)chemistry.chemical_compound0203 mechanical engineeringNatural rubberGeneral Materials ScienceComposite materialSofteninglcsh:Mining engineering. Metallurgyhysteresis losses.Mullins effecttechnology industry and agricultureMullins effect021001 nanoscience & nanotechnologyMicrostructurefilled rubberbody regionsHysteresis020303 mechanical engineering & transportschemistryvisual_artvisual_art.visual_art_mediumfilled rubber Mullins effect stress softening hysteresis lossesDeformation (engineering)0210 nano-technologyMedžiagotyra
researchProduct

Augmentation of weld penetration by flux assisted TIG welding and its distinct variants for oxygen free copper

2021

Abstract A comparative study to investigate the influences of single component fluxes on the depth-to-width ratio (DWR) of oxygen free copper was carried out with novel variants of tungsten inert gas (TIG) welding namely Activated TIG (A-TIG), Flux Bounded TIG (FB-TIG) and Flux Zoned TIG (FB-TIG) processes. The experiments to identify the fluxes delivering the higher DWRs in A-TIG welding among thirteen distinct fluxes were followed by the trials with FB-TIG and FZ-TIG employing those identified DWR fluxes. The fluxes which outperformed with all the techniques were MoO3 & MgO. Reversed Marangoni and arc constriction mechanisms were perceived to be opt for such an increase in DWR. Metallurgi…

lcsh:TN1-997Oxygen-free copperMaterials scienceWeld penetrationFZ-TIG Weldingchemistry.chemical_element02 engineering and technologyWeldingTungsten01 natural scienceslaw.inventionBiomaterialsFlux (metallurgy)law0103 physical sciencesInert gasSettore ING-IND/16 - Tecnologie E Sistemi Di Lavorazionelcsh:Mining engineering. Metallurgy010302 applied physicsFluxMarangoni effectGas tungsten arc weldingMetallurgyOxideMetals and AlloysWeld penetrationA-TIG021001 nanoscience & nanotechnologySurfaces Coatings and FilmschemistryCeramics and Composites0210 nano-technologyCopperJournal of Materials Research and Technology
researchProduct

Characterisation of the microflora contaminating the wooden vats used for traditional Sicilian cheese production

2015

Traditional Sicilian cheese productions are carried out employing traditional wooden vats, called <em>tina.</em> Many studies have highlighted the beneficial role of wooden dairy equipment by contributing to enriching the milk microflora and improving the acidification processes. The present work was undertaken to evaluate the safety of the wooden vats used to coagulate milk. To this purpose, the different microbial populations hosted onto the internal surfaces of the vats used to produce two different stretched cheeses, namely <em>Caciocavallo Palermitano</em> and <em>Vastedda della valle del Belìce DOP</em>, were investigated for the presence of spoilag…

lcsh:TP368-456Biofilm; Food safety; Inhibitory activity; Sicilian cheese; Wooden vat; Food ScienceBiofilmMicroorganismFood spoilageInhibitory activityBiologymedicine.disease_causebiology.organism_classificationArticleWooden vatFood safetylcsh:Food processing and manufactureListeria monocytogenesSicilian cheesemedicineListeriaFood scienceInhibitory effectBacteriaSettore AGR/16 - Microbiologia AgrariaWooden vat Biofilm Sicilian cheese Inhibitory activity Food safetyFood ScienceItalian Journal of Food Safety
researchProduct

Towards a sustainable leader-follower relationship: constructive dissensus, organizational virtuousness and happiness at work (haw)

2020

This paper examines how leaders and followers can interact positively under complex and bounded conditions. For this purpose, this paper conceptualizes and measures the concept of constructive dissensus. Constructive dissensus relates to a mutual understanding leading to a situation of coregulation. In addition, the relationship between constructive dissensus and happiness at work is examined on the basis of affective events theory. Furthermore, the mediating role of organizational virtuousness is assessed. Through structural equation modeling, a multilevel analysis was performed. Data from 130 bank branches and 606 employees were gathered. The results reveal a direct effect of constructive…

leadershipGeography Planning and DevelopmentTJ807-830050109 social psychologyAffective events theoryManagement Monitoring Policy and LawTD194-195:CIENCIAS ECONÓMICAS [UNESCO]ConstructiveRenewable energy sourcesStructural equation modeling0502 economics and businessFollowershipGE1-3500501 psychology and cognitive sciencesHappiness at workEnvironmental effects of industries and plantsRenewable Energy Sustainability and the Environment05 social sciencesMultilevel modelorganizational virtuousnesshappiness at workUNESCO::CIENCIAS ECONÓMICASEnvironmental sciencesBounded functionMediationPsychologySocial psychology050203 business & managementfollowership
researchProduct

Antecedents of daily team job crafting

2017

This study investigated potential antecedents of team job crafting defined as the extent to which team members engage together in increasing (social and structural) job resources and challenges, and decreasing hindering job demands. Mindful of the teamwork literature, we hypothesized that individual employee factors (self-efficacy for teamwork, daily affect), team features (team cohesion, climate) and the organizational context of teams (engaging leadership and organizational resources for teamwork) relate positively to daily team job crafting behaviour. Data were collected among 46 multi-professional rehabilitation teams whose members completed two daily surveys after their weekly meetings…

leadershipOrganizational Behavior and Human Resource Managementmedia_common.quotation_subjectApplied psychologyPsychological interventionTeam effectiveness050109 social psychologyPsychological safetyAffect (psychology)teamsJob craftingproactive behaviour0502 economics and businessTaverne0501 psychology and cognitive sciencesJob craftingta515Applied Psychologymedia_commonTeam compositionTeamworkComputingMilieux_THECOMPUTINGPROFESSION05 social sciencesCohesion (linguistics)antecedentsPsychologySocial psychology050203 business & management
researchProduct

A Framework of Professional Transferable Competences for System Innovation: Enabling Leadership and Agency for Sustainable Development

2021

System Innovation (SI) is a critical approach in driving individual and collective actions towards sustainable development (SD). This article presents the validation process of the Climate-KIC Professional Competence Framework (CF) for SI. This framework is based on principles of system thinking and the need for human capital to deal with challenges related to long-term sustainability. It comprises twenty competences grouped into five stages that describe contexts where professionals implement transformations: Exploring, Framing, Designing, Implementing and Strengthening. The stages are not linear or strictly sequential because overlapping and loops are frequent in transformational and disr…

leadershipcompetence frameworkProcess managementGeography Planning and DevelopmentTJ807-830CertificationManagement Monitoring Policy and LawTD194-195Human capitalRenewable energy sourcesAgency (sociology)Systems thinkinghuman capitalGE1-350disruptiveSustainable developmentsustainable developmentsystem thinkingEnvironmental effects of industries and plantsRenewable Energy Sustainability and the Environmentprofessional transferable competencesEnvironmental sciencesTransformational leadershipSustainabilityBusinesssystem innovationSocial capitaltransformationalSustainability
researchProduct

Which Factors Modulate Letter Position Coding in Pre-literate Children?

2021

One of the central landmarks of learning to read is the emergence of orthographic processing (i.e., the encoding of letter identity and letter order): it constitutes the necessary link between the low-level stages of visual processing and the higher-level processing of words. Regarding the processing of letter position, many experiments have shown worse performance in various tasks for the transposed-letter pair judge-JUDGE than for the orthographic control jupte-JUDGE. Importantly, 4-y.o. pre-literate children also show letter transposition effects in a same-different task: TZ-ZT is more error-prone than TZ-PH. Here, we examined whether this effect with pre-literate children is related to …

learning to readmedia_common.quotation_subjectpre-literate050105 experimental psychologyTask (project management)Visual processing03 medical and health sciencesorthographic processing0302 clinical medicineReading (process)cognitive processingLearning to readPsychology0501 psychology and cognitive sciencesGeneral Psychologymedia_common05 social sciencesCognitionBrief Research Reporttransposed-letter effectBF1-990Metalinguistic awarenessPsychology030217 neurology & neurosurgeryCognitive psychologyTransposed letter effectCoding (social sciences)Frontiers in Psychology
researchProduct

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct

On the Dissociation of Word/Nonword Repetition Effects in Lexical Decision: An Evidence Accumulation Account

2016

A number of models of visual-word recognition assume that the repetition of an item in a lexical decision experiment increases that item's familiarity/wordness. This would produce not only a facilitative repetition effect for words, but also an inhibitory effect for nonwords (i.e., more familiarity/wordness makes the negative decision slower). We conducted a two-block lexical decision experiment to examine word/nonword repetition effects in the framework of a leading “familiarity/wordness” model of the lexical decision task, namely, the diffusion model (Ratcliff et al., 2004). Results showed that while repeated words were responded to faster than the unrepeated words, repeated nonwords were…

lexical decisionrepetitionDissociation (neuropsychology)Speech recognitionlcsh:BF1-99005 social sciencesWord processingdiffusion model050105 experimental psychology03 medical and health sciencesRT distributionslcsh:Psychology0302 clinical medicineLexical decision taskPsychology0501 psychology and cognitive sciencesWord ProcessingPsychologyInhibitory effect030217 neurology & neurosurgeryGeneral PsychologyOriginal ResearchFrontiers in Psychology
researchProduct