Search results for " enzyme"

showing 10 items of 791 documents

IFI16 expression is related to selected transcription factors during B-cell differentiation

2015

The interferon-inducible DNA sensor IFI16 is involved in the modulation of cellular survival, proliferation, and differentiation. In the hematopoietic system, IFI16 is consistently expressed in the CD34+ stem cells and in peripheral blood lymphocytes; however, little is known regarding its regulation during maturation of B- and T-cells. We explored the role of IFI16 in normal B-cell subsets by analysing its expression and relationship with the major transcription factors involved in germinal center (GC) development and plasma-cell (PC) maturation.IFI16mRNA was differentially expressed in B-cell subsets with significant decrease inIFI16mRNA in GC and PCs with respect to naïve and memory subs…

lcsh:Immunologic diseases. AllergyAdultMaleXBP1Article SubjectLymphoid TissueTranscription FactorCellular differentiationPlasma CellsImmunologyB-Lymphocyte SubsetsBiologySettore MED/08 - Anatomia PatologicaAdult; B-Lymphocyte Subsets; B-Lymphocytes; Enzyme Activation; Female; Gene Expression Profiling; Germinal Center; Humans; Lymphoid Tissue; Male; NF-kappa B; Nuclear Proteins; Phosphoproteins; Plasma Cells; RNA Messenger; Transcription Factors; Cell Differentiation; Gene Expression Regulation; Immunology; Immunology and AllergyGene expressionImmunology; Immunology and AllergyHumansImmunology and AllergyRNA MessengerTranscription factorB-Lymphocyte SubsetsNuclear ProteinRegulation of gene expressionB-Lymphocyte SubsetB-LymphocytesRELBGene Expression ProfilingB-LymphocyteNF-kappa BNuclear ProteinsCell DifferentiationGeneral MedicineB-Cell DifferentiationPhosphoproteinsGerminal CenterMolecular biologyGene expression profilingEnzyme ActivationGene Expression RegulationPhosphoproteinImmunology interferon-inducible DNA sensor IFI16 B-Cell DifferentiationPlasma Cellinterferon-inducible DNA sensor IFI16Femalelcsh:RC581-607Transcription FactorsResearch ArticleHuman
researchProduct

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct

Leukocyte activation markers and oxidative status in chronic kidney disease

2013

leukocyte enzymes chronic renal failure
researchProduct

Influence of odorant metabolism on human olfactory perception

2018

The sense of smell permits the perception of volatile substances commonly known as odors. This sense plays an important role in the feeding and wellness of individuals because it involves exchanges with their environment (search for food or partners, predators detection…). The efficiency of the olfactory system mainly relies on its sensitivity depending on the odorant affinity for their olfactory receptors but also on an enzymatic clearance mechanism of odorants which involves the Odorant metabolizing Enzymes (OME) to avoid the saturation of the receptors. Recent studies have shown that the biotransformation of odorants by EMO, in the olfactory epithelium, participates in the olfactory perc…

mebolism enzymes[SDV.AEN] Life Sciences [q-bio]/Food and Nutritionvolatil organic compoundsanalytical biochemistrythesexenobiotic metabolismolfaction
researchProduct

Expression and characterization of the recombinant juvenile hormone epoxide hydrolase (JHEH) from Manduca sexta.

1998

The cDNA of the microsomal Juvenile Hormone Epoxide Hydrolase (JHEH) from Manduca sexta was expressed in vitro in the baculovirus system. In insect cell culture, the recombinant enzyme (Ms-JHEH) was produced at a high level (100 fold over background EH catalytic activity). As expected, Ms-JHEH was localized in the microsomal fraction with a molecular mass of approximately 50 kDa. Ms-JHEH showed a substrate and inhibitor spectrum similar to the wild type JHEH isolated from eggs of M. sexta. Its enzymatic activity was the highest for Juvenile Hormone III. Ms-JHEH hydrolyzed several trans-epoxides faster than cis-epoxides. A putative hydroxyl-acyl enzyme intermediate was isolated suggesting a …

mechanismGene ExpressionBiochemistryPolymerase Chain ReactionSubstrate SpecificityManduca sextaManducaHydrolaseAnimalsEpoxide hydrolaserecombinant enzymeMolecular BiologyDNA Primerschemistry.chemical_classificationEpoxide HydrolasesbiologyMolecular massBase Sequencejuvenile hormoneInsect cell cultureHydrogen-Ion Concentrationbiology.organism_classificationMolecular biologyRecombinant Proteinsepoxide hydrolaseJuvenile HormonesEnzymechemistryBiochemistryManduca sextaInsect ScienceJuvenile hormoneManducaBaculoviridaeInsect biochemistry and molecular biology
researchProduct

Monoclonal antibodies against components of the classical pathway of complement.

1989

Activation of the classical pathway of complement involves several binding and enzymatic cleavage processes. Binding and enzymatic activation results in the appearance of new structures in the individual components. This report describes the different activation steps for C1q, C1r, C1s, C4 and C2 and summarizes monoclonal antibodies reported so far which recognize either conserved epitopes or activation-dependent epitopes with particular emphasis on neoepitopes occurring during the activation cascade.

medicine.drug_classComplement Activating EnzymesImmunologyComplement C3-C5 ConvertasesComplement C3-C5 ConvertasesMonoclonal antibodyEpitopeClassical complement pathwayEpitopesComplement C1medicineComplement Pathway ClassicalComplement C1qComplement ActivationComplement component 2biologyChemistryComplement C1qAntibodies MonoclonalComplement C4HematologyComplement System ProteinsComplement C2Complement systemBiochemistrybiology.proteinAntibodyComplement and inflammation
researchProduct

Does the renin-angiotensin system also regulate intra-ocular pressure?

2009

The renin-angiotensin-aldosterone system is known to play an essential role in controlling sodium balance and body fluid volumes, and thus blood pressure. In addition to the circulating system which regulates urgent cardiovascular responses, a tissue-localized renin-angiotensin system (RAS) regulates long-term changes in various organs. Many recognized RAS components have also been identified in the human eye. The highly vasoconstrictive angiotensin II (Ang II) is considered the key peptide in the circulatory RAS. However, the ultimate effect of RAS activation at tissue level is more complex, being based not only on the biological activity of Ang II but also on the activities of other produ…

medicine.medical_specialty030204 cardiovascular system & hematologyPeptide hormoneRenin-Angiotensin System03 medical and health sciences0302 clinical medicineInternal medicineRenin–angiotensin systemMedicineAnimalsHumansIntraocular Pressurebiologybusiness.industryAngiotensin-converting enzymeBiological activityGeneral MedicineWater-Electrolyte BalanceAngiotensin IIBiosynthetic PathwaysBlood pressureEndocrinologyACE inhibitorCirculatory system030221 ophthalmology & optometrybiology.proteinOcular Hypertensionbusinessmedicine.drugAnnals of medicine
researchProduct

An epidemiological study exploring a possible impact of treatment with ACE inhibitors or angiotensin receptor blockers on ACE2 plasma concentrations

2020

medicine.medical_specialty2019-20 coronavirus outbreakCoronavirus disease 2019 (COVID-19)business.industrySevere acute respiratory syndrome coronavirus 2 (SARS-CoV-2)COVID-19Angiotensin-Converting Enzyme InhibitorsPharmacologyPolymorphism Single NucleotideAngiotensin Receptor AntagonistsEpidemiologic StudiesRisk FactorsEpidemiologyPlasma concentrationmedicineHumansAngiotensin-Converting Enzyme 2Angiotensin Receptor BlockersCardiology and Cardiovascular MedicinebusinessMolecular BiologyJournal of Molecular and Cellular Cardiology
researchProduct

Changes of Angiotensin Converting Enzyme (Ace) Levels During Activation of the Renin-Angiotensin-Aldosterone System (RAAs)

1987

The aim of this study was to evaluate the changes of ACE levels during RAAs activation induced by: 1) a continuous graded bicycle ergometer test performed in a group of 15 males health youths aged between 21 and 30 years, with average age of 25.8 +/- 2.85 years; 2) i.m. injection of 20 mg of frusemide in 11 health youths (10 males and 1 female), aged between 20 and 30 years, with average age of 24.09 +/- 2.77 years; 3) dialytic treatment in 25 patients (12 males and 13 females), suffering from chronic renal failure, aged between 26 and 68 years, with average age of 54 +/- 15.42 years. Plasmatic renin activity (PRA), aldosterone (ALD) and ACE levels were determined by RIA in basal conditions…

medicine.medical_specialtyAldosteronebiologybusiness.industrymedicine.medical_treatmentAngiotensin-converting enzymePlasma renin activityBasal (phylogenetics)chemistry.chemical_compoundEndocrinologychemistryInternal medicineRenin–angiotensin systembiology.proteinMedicineChronic renal failureBicycle ergometerbusinessDialysis
researchProduct

Angiotensin-Converting Enzyme 2 and Antihypertensives (Angiotensin Receptor Blockers and Angiotensin-Converting Enzyme Inhibitors) in Coronavirus Dis…

2020

Coronavirus disease 2019 (COVID-19), caused by severe acute respiratory syndrome coronavirus 2, is being defined as the worst pandemic disease of modern times. Several professional health organizations have published position papers stating that there is no evidence to change the use of angiotensin-converting enzyme inhibitors (ACEIs) or angiotensin receptor blockers (ARBs) in the management of elevated blood pressure in the context of avoiding or treating COVID-19 infection. In this article, we review the evidence on the relationship between the renin-angiotensin-aldosterone system and COVID-19 infection. In agreement with current guidelines, patients with hypertension should continue taki…

medicine.medical_specialtyAngiotensin-Converting Enzyme030204 cardiovascular system & hematology03 medical and health sciences0302 clinical medicineInternal medicineDiabetes mellitusmedicinecardiovascular diseases030212 general & internal medicineAdverse effectbiologyAngioedemabusiness.industryCOVID-19Angiotensin-converting enzymeGeneral Medicinemedicine.diseaseCoronavirusBlood pressureAngiotensin-Converting Enzyme Coronavirus COVID-19Heart failureAngiotensin-converting enzyme 2biology.proteinmedicine.symptombusinessKidney diseaseMayo Clinic Proceedings
researchProduct