Search results for " malattie."

showing 10 items of 1941 documents

Allergic sensitization to common pets (cats/dogs) according to different possible modalities of exposure: an Italian Multicenter Study

2018

Abstract Background The query “are there animals at home?” is usually administered for collecting information on anamnesis. This modality to consider exposure to pet allergens constitutes a potential bias in epidemiological studies and in clinical practice. The aim of our study was to evaluate/quantify different modalities of exposure to cat/dog in inducing allergic sensitization. Methods Thirty Italian Allergy units participated in this study. Each centre was required to collect the data of at least 20 consecutive outpatients sensitized to cat/dog allergens. A standardized form reported all demographic data and a particular attention was paid in relieving possible modalities of exposure to…

lcsh:Immunologic diseases. AllergyAllergymedicine.medical_specialtyImmunologySettore MED/10 - Malattie Dell'Apparato RespiratorioPets exposureAllergic rhinitisAllergic sensitization03 medical and health sciences0302 clinical medicineInternal medicineEpidemiologyAllergic rhinitiDogHypersensitivitymedicineImmunology and Allergy030212 general & internal medicineAllergic rhinitis Allergic sensitization Bronchial asthma Cat; Dog Hypersensitivity Pets Pets exposure Immunology and Allergy Immunology Molecular BiologyBronchial asthmaMolecular BiologyAllergic rhinitis; Allergic sensitization; Bronchial asthma; Cat; Dog; Hypersensitivity; Pets; Pets exposureAllergic sensitizationAnamnesisCATSModalitiesbusiness.industryResearchCatPetsmedicine.diseasePet ownershipPet030228 respiratory systemMulticenter studyAllergic rhinitis; Allergic sensitization; Bronchial asthma; Cat; Dog; Hypersensitivity; Pets; Pets exposure; Immunology and Allergy; Immunology; Molecular Biologylcsh:RC581-607businessClinical and Molecular Allergy
researchProduct

Tiotropium in asthma: Back to the future of anticholinergic treatment

2017

Abstract Asthma is among the most common chronic diseases worldwide; however, despite progresses in the understanding of the patho-physiological mechanisms and advances in the development of new therapeutic options and strategies, the disease remains uncontrolled in a not trivial proportion of subjects. Thus, the need of new molecules to treat the underlying biological and functional abnormalities and to control symptoms is strongly advocated by clinicians. In this scenario, the most recent GINA guidelines have included the use of tiotropium bromide in the most severe and uncontrolled forms of the disease, in addition to treatment with inhaled corticosteroid plus long acting beta adrenergic…

lcsh:Immunologic diseases. AllergyEndotypeAllergymedicine.medical_specialtyExacerbationmedicine.drug_classPopulationAntimuscarinicImmunologyReviewDiseaseAnticholinergicSettore MED/10 - Malattie Dell'Apparato RespiratorioEndotype03 medical and health sciences0302 clinical medicineControlmedicineAnticholinergicImmunology and Allergy030212 general & internal medicineeducationIntensive care medicineMolecular BiologyAsthmaeducation.field_of_studybusiness.industryTiotropiumExacerbationTiotropium bromidemedicine.diseaseAsthmaPhenotype030228 respiratory systemBronchodilationlcsh:RC581-607businessmedicine.drug
researchProduct

Vitamin D, allergies and asthma: focus on pediatric patients

2014

In recent years, the interest of the scientific world towards vitamin D gradually increased, and several studies have been conducted to dissect its possible role in modulating the development/course of allergic diseases. Also, Vitamin D supplementation has been assessed as a beneficial approach for treating allergies in some, but not all studies. We reviewed herein the available and relevant literature concerning the possible links between Vitamin D, its supplementation and allergic diseases. A literature search was made independently by the Authors, identifying articles for a narrative review. As per literature, Vitamin D plays a key role in calcium and phosphate metabolism, and it is esse…

lcsh:Immunologic diseases. AllergyPulmonary and Respiratory MedicineAllergymedicine.medical_specialtyPediatricsSupplementationSettore MED/10 - Malattie dell'Apparato RespiratorioImmunologyAlternative medicinePediatric allergyReviewBone healthVitamin D allergic diseases immunomodulation suppplementation asthma rhinitis pediatric allergyImmunomodulationSettore MED/38 - Pediatria Generale E SpecialisticaFood allergymedicineVitamin D and neurologyImmunology and AllergyVitamin DVitamin D; Allergic diseases; Immunomodulation; Supplementation; Asthma; Rhinitis; Pediatric allergyAsthmaRhinitisVitamin d supplementationbusiness.industryAllergic diseasesAllergic diseases; Asthma; Immunomodulation; Pediatric allergy; Rhinitis; Supplementation; Vitamin DAtopic dermatitismedicine.diseaseAsthmaImmunologylcsh:RC581-607businessWorld Allergy Organization Journal
researchProduct

Catching allergy by a simple questionnaire

2014

Background Identifying allergic rhinitis requires allergy testing, but the first-line referral for rhinitis are usually primary care physicians (PCP), who are not familiar with such tests. The availability of easy and simple tests to be used by PCP to suggest allergy should be very useful. Methods The Respiratory Allergy Prediction (RAP) test, based on 9 questions and previously validated by a panel of experts, was evaluated in this study. Results An overall number of 401 patients (48.6% males, age range 14–62 years) with respiratory symptoms was included. Of them, 89 (22.2%) showed negative results to SPT, while 312 (77.8%) had at least one positive result to SPT. Cohen’s kappa coefficient…

lcsh:Immunologic diseases. AllergyPulmonary and Respiratory MedicinePediatricsmedicine.medical_specialtyAllergyReferralAllergymedicine.medical_treatmentImmunologyAllergy testingPrimary careAllergy testingSettore MED/10 - Malattie Dell'Apparato RespiratorioPharmacistsAllergic rhinitisCohen's kappaAllergic rhinitimedicineImmunology and AllergyOriginal Researchbusiness.industrymedicine.diseaseAllergic rhinitis; Allergy; Allergy testing; Pharmacists; Primary care physicians; Immunology and AllergyTest (assessment)Primary care physicianNasal sprayPharmacistPrimary care physiciansAllergistslcsh:RC581-607business
researchProduct

Adherence to omalizumab: A multicenter “real-world” study

2020

Background: Adherence to medications is crucial in patients with severe asthma in light of the negative clinical impact and costs of non-adherence. Adherence to omalizumab has not been well studied in real-world settings. The aim of this study was to assess adherence to omalizumab and evaluate treatment effectiveness in relation to adherence. Methods: This was a retrospective, observational, and multicenter real-world study. Omalizumab dose, timing of administration, and duration of treatment ( 4 years) were analyzed. Adherence was evaluated by examining rates of expected and missing doses. Good adherence (10% doses missed) were determined. For effectiveness in relation to adherence of omal…

lcsh:Immunologic diseases. AllergyPulmonary and Respiratory Medicinemedicine.medical_specialtySevere asthmaEfficacySevere asthmaImmunologyOmalizumabOmalizumabSettore MED/10 - Malattie Dell'Apparato RespiratorioArticlePoor adherence03 medical and health sciences0302 clinical medicineInternal medicineImmunology and AllergyMedicineIn patient030223 otorhinolaryngologyAsthmaAsthma exacerbationsbusiness.industrySevere asthma Omalizumab Adherence Efficacy Real-worldmedicine.disease030228 respiratory systemReal-worldAdherenceObservational studylcsh:RC581-607businessAsthma Control Testmedicine.drug
researchProduct

Challenges in dental statistics: survey methodology topics

2022


 This paper gathers some contributions concerning survey methodology in dental research, as discussed during the first Workshop of the SISMEC STATDENT working group on statistical methods and applications in dentistry, held in Ancona on the 28th September 2011.
 The first contribution deals with the European Global Oral Health Indicators Development (EGOHID) Project which proposed a comprehensive and standardized system of epidemiological tools (questionnaires and clinical forms) for national data collection on oral health in Europe. The second contribution regards the design and conduct of trials to evaluate the clinical efficacy and safety of toothbrushes and mouthrinses. Final…

lcsh:R5-920Medical educationbusiness.industryDental researchlcsh:Public aspects of medicineDentistrylcsh:RA1-1270Oral healthDental agetoothbrushSettore MED/01 - Statistica Medicadental research oral health mouthrinse toothbrush dental age statisticsdental age; dental research; mouthrinse; oral health; statistics; toothbrushSurvey methodologymouthrinseSettore MED/28 - Malattie Odontostomatologichestatisticsoral healthMedicinedental researchClinical efficacylcsh:Medicine (General)businessdental ageNational dataEpidemiology, Biostatistics, and Public Health
researchProduct

Risk of Periodontal Disease: Is there a Correlation with the Type of Antihypertensive Medication?

2011

Introduction: The purpose of this study was to evaluate the effects of long-term oral antihypertensive treatment using centrally acting sympatho-inhibitory drugs (clonidine) and beta-blockers (metoprolol) on capillary microcirculation in the labial and periodontal mucosa.
 Methods: Sixty subjects were recruited for the study: 20 patients affected by hypertension in treatment with centrally-acting sympatho-inhibitory drugs (64.28 ± 11.78 years); 20 patients in treatment with beta-blockers (62.03 ± 9.84 years) and 20 healthy subjects (62.06 ± 6.72 years). We use the videocapillaroscopic technique to evaluate in vivo the microcirculation of the labial mucosa corresponding to the lower lip…

lcsh:R5-920medicine.medical_specialtymedicine.drug_classbusiness.industryGeneral MedicineGastroenterologyMicrocirculationSurgeryClonidinestomatognathic diseasesPharmacotherapyBlood pressureOral administrationSettore MED/28 - Malattie OdontostomatologicheInternal medicinemedicineHypertension antihypertensive drug oral videocapillaroscopyLabial Mucosalcsh:Medicine (General)Antihypertensive drugbusinessMetoprololmedicine.drug
researchProduct

Fever and dyspnoea in a tracheostomised patient

2020

A 65-year-old man was referred for evaluation of acute onset of fever, productive cough and dyspnoea. He had previously received a diagnosis of laryngeal carcinoma, which had been treated with laryngectomy and bilateral laterocervical lymphadenectomy, followed by chemotherapy. He underwent plastic surgery of the laryngocutaneous fistula, and a positron emission tomography (PET)- computed tomography (CT) examination performed during follow-up showed 18-FDG (2-fluoro-2-deoxyd- glucose) lung uptake in the apical right portion. He had a smoking history and his regular medications included dexamethasone, metoclopramide, omeprazole, furosemide, cholecalciferol and pregabalin. He had a history of …

lcsh:RC705-779Pulmonary and Respiratory Medicinemedicine.medical_specialtybusiness.industrylung fibrosisMEDLINECase Reportlcsh:Diseases of the respiratory systemtomographySettore MED/10 - Malattie Dell'Apparato RespiratorioExpert Opinionoilrespiratory tract diseases18Emergency medicineMedicinebusiness
researchProduct

Acromion clavicular joint reconstruction with LArS ligament in acute dislocation

2019

Background: The acromion clavicular joint dislocations are common injuries of the shoulder. The severity is dependent upon the degree of ligamentous injury. Surgical treatment is typically performed in higher grade acromioclavicular separation with several static and dynamic operative procedures with or without primary ligament replacement. Methods: 47 patients with acute Rockwood type III, IV, and V injuries were treated surgically with LARS reconstruction. The success of technique was evaluated by radiographic outcomes for each patient at every follow-up visit (one,three, 12 months), while to assess pain reduction and clinical evaluation Visual Analogue scale score (VAS) and Constant-Murl…

lcsh:RD701-811lcsh:Orthopedic surgerySettore MED/33 - Malattie Apparato Locomotorecoracoid procecoracoclavicular ligament reconstructionacromionclavicular jointshoulder injurycoracoid process
researchProduct

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct