Search results for "Accelerator physics"

showing 10 items of 1294 documents

Plasma diagnostic tools for ECR ion sources : What can we learn from these experiments for the next generation sources

2019

International audience; The order-of-magnitude performance leaps of ECR ion sources over the past decades result from improvements to the magnetic plasma confinement, increases in the microwave heating frequency, and techniques to stabilize the plasma at high densities. Parallel to the technical development of the ion sources themselves, significant effort has been directed into the development of their plasma diagnostic tools. We review the recent results of Electron Cyclotron Resonance Ion Source (ECRIS) plasma diagnostics highlighting a number of selected examples of plasma density, electron energy distribution, and ion confinement time measurements, obtained mostly with the second-gener…

[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Solenoidmagnetic fieldshiukkaskiihdyttimetplasmafysiikka7. Clean energy01 natural sciencesbremsstrahlungElectron cyclotron resonance010305 fluids & plasmasIonoptical emission spectroscopySuperposition principleion sourcesPhysics::Plasma Physics0103 physical sciencesInstrumentation010302 applied physicsPhysics[PHYS]Physics [physics]plasma confinementplasma properties and parametersplasma diagnosticssyklotronitplasma heatingPlasmaIon sourceComputational physicsMagnetic fieldPlasma diagnostics
researchProduct

All-Optical Measurement of Background, Amplitude and Timing Jitter for high speed pulse trains or prbs sequences using autocorrelation function

2006

We present a simple method for all-optical measurements of background, amplitude- and timing-jitter of ultra high speed pulse trains or prbs sequences using the jitter dependences of the intercorrelation-peak shape.

[PHYS.PHYS.PHYS-OPTICS] Physics [physics]/Physics [physics]/Optics [physics.optics]Optical fiber02 engineering and technology01 natural sciencesPseudorandom binary sequencelaw.invention010309 optics020210 optoelectronics & photonicsOpticsHardware_GENERALlawComputer Science::Multimedia0103 physical sciencesHardware_INTEGRATEDCIRCUITS0202 electrical engineering electronic engineering information engineeringComputingMilieux_MISCELLANEOUSJitterPhysics[PHYS.PHYS.PHYS-OPTICS]Physics [physics]/Physics [physics]/Optics [physics.optics][ PHYS.PHYS.PHYS-OPTICS ] Physics [physics]/Physics [physics]/Optics [physics.optics]Pulse (signal processing)business.industryAutocorrelationComputer Science::PerformanceAmplitudePhysics::Accelerator PhysicsTrainbusinessDegradation (telecommunications)
researchProduct

Gain sideband splitting in dispersion oscillating fibers

2014

International audience; We analyze the modulation instability spectrum in a varying dispersion optical fiber as a function of the dispersion oscillation amplitude, and predict a novel sideband splitting into different sub-sidebands for relatively large dispersion oscillations

[PHYS.PHYS.PHYS-OPTICS] Physics [physics]/Physics [physics]/Optics [physics.optics]Physics[PHYS.PHYS.PHYS-OPTICS]Physics [physics]/Physics [physics]/Optics [physics.optics]Optical fiber[ PHYS.PHYS.PHYS-OPTICS ] Physics [physics]/Physics [physics]/Optics [physics.optics]Sidebandbusiness.industryPhysics::Optics01 natural sciencesMolecular physicslaw.invention010309 opticsFour-wave mixingOpticsZero-dispersion wavelengthModulationPolarization mode dispersionlaw0103 physical sciencesDispersion (optics)Modal dispersionPhysics::Accelerator Physics010306 general physicsbusiness
researchProduct

Stabilisation of modelocking in fibre ring laser through pulse bunching

2001

Bunching of equally spaced pulses is reported to be the most stable mode of operation in a passively modelocked fibre ring laser. The ring includes dispersion management, which results in the absence of strict pulse energy quantisation, giving pulse bunching a better immunity to environmental perturbation.

[PHYS.PHYS.PHYS-OPTICS] Physics [physics]/Physics [physics]/Optics [physics.optics][PHYS.PHYS.PHYS-OPTICS]Physics [physics]/Physics [physics]/Optics [physics.optics]Materials science[ PHYS.PHYS.PHYS-OPTICS ] Physics [physics]/Physics [physics]/Optics [physics.optics]business.industryRing laser01 natural sciences010309 opticsOptics0103 physical sciencesLaser mode lockingPhysics::Accelerator PhysicsElectrical and Electronic Engineering010306 general physicsPulse energybusinessBandwidth-limited pulseComputingMilieux_MISCELLANEOUS
researchProduct

Multidimensional shaping of spatiotemporal waves in multimode nonlinear fibers

2019

Recent experiments have shown that nonlinear wave propagation in multimode optical fibers leads to complex spatio-temporal phenomena. In this talk, we introduce new approaches for the control and optimization of nonlinear beam reshaping in the spatial, temporal and spectral dimensions. The first approach applies to spatial beam self-cleaning the technique of transverse wavefront shaping, which permits to launch an optimized input mode combination, that results in the stable generation of a whole nonlinear mode alphabet at the fiber output. The second approach introduces a longitudinal tapering of the core diameter of multimode active and passive fibers, which permits to generate ultra-wideb…

[PHYS.PHYS.PHYS-OPTICS] Physics [physics]/Physics [physics]/Optics [physics.optics]multimode optical fibersOptical fiberPhysics::OpticsTapering02 engineering and technologyTransverse effectsSupercontinuum generation01 natural scienceslaw.invention010309 opticsOpticsKerr effectlawNonlinear fiber optics0103 physical sciencessolitonsComputingMilieux_MISCELLANEOUSPhysicsWavefront[PHYS.PHYS.PHYS-OPTICS]Physics [physics]/Physics [physics]/Optics [physics.optics]Multi-mode optical fiberbusiness.industrynonlinear opticsFiber amplifiersmultimode optical fibers; fiber lasers; nonlinear optics; solitons021001 nanoscience & nanotechnologyfiber lasersSupercontinuumNonlinear systemPhysics::Accelerator PhysicsFiber amplifiers; Kerr effect; Nonlinear fiber optics; Supercontinuum generation; Transverse effectsLaser beam quality0210 nano-technologybusinessBeam (structure)
researchProduct

Spatio-Temporal Beam Mapping for Studying Nonlinear Dynamics in Graded Index Multimode Fiber

2020

We experimentally demonstrate high-resolution mapping of the spatio-temporal dynamics of the beam cleaning process in graded index multimode fibers. This high-resolution characterization reveals the time-dependent nature of the beam self-cleaning process.

[PHYS.PHYS.PHYS-OPTICS] Physics [physics]/Physics [physics]/Optics [physics.optics]optical fibersOptical fiberMaterials scienceKerr effect02 engineering and technology01 natural scienceslaw.invention010309 opticssymbols.namesakeOpticsKerr effectlaw0103 physical sciencesComputingMilieux_MISCELLANEOUS[PHYS.PHYS.PHYS-OPTICS]Physics [physics]/Physics [physics]/Optics [physics.optics]Multi-mode optical fiberbusiness.industry021001 nanoscience & nanotechnologyCharacterization (materials science)beam cleaningNonlinear systembeam cleaning; optical fibers; Kerr effectTemporal resolutionsymbolsPhysics::Accelerator Physics0210 nano-technologybusinessRaman scatteringBeam (structure)
researchProduct

Kerr Beam Self-Cleaning in Multimode Fibers

2018

We overview recent experimental results of beam self-cleaning observed in various types of multimode fibers. We analyze the output spatial beam shapes and their connection with the refractive index profile of the fibers.

[PHYS.PHYS.PHYS-OPTICS]Physics [physics]/Physics [physics]/Optics [physics.optics]Materials scienceMulti-mode optical fiberbusiness.industrymultimode fibers; Kerr effect; optical instabilitiesPhysics::Optics02 engineering and technologyRefractive index profile021001 nanoscience & nanotechnology01 natural sciencesoptical instabilitiesmultimode fibersConnection (mathematics)010309 opticsOpticsKerr effectSelf cleaning0103 physical sciencesPhysics::Accelerator PhysicsBeam shaping0210 nano-technologybusinessRefractive indexBeam (structure)ComputingMilieux_MISCELLANEOUS
researchProduct

Ionization energy of gas phase protein cations and its dependence on charge state_and structure

2013

Ionization energy of gas phase protein cations and its dependence on charge state_and structure. Synchrotron SOLEIL Users Meeting

[SDV.OT]Life Sciences [q-bio]/Other [q-bio.OT][SDV.OT] Life Sciences [q-bio]/Other [q-bio.OT][CHIM.OTHE] Chemical Sciences/Other[ SDU.OTHER ] Sciences of the Universe [physics]/Other[ CHIM.OTHE ] Chemical Sciences/OtherAstrophysics::High Energy Astrophysical PhenomenaPhysics::Atomic and Molecular ClustersPhysics::Accelerator Physics[SDU.OTHER] Sciences of the Universe [physics]/Other[ SDV.OT ] Life Sciences [q-bio]/Other [q-bio.OT]Physics::Chemical Physics[SDU.OTHER]Sciences of the Universe [physics]/Other[CHIM.OTHE]Chemical Sciences/Other
researchProduct

Search for Higgs boson pair production in the two bottom quarks plus two photons final state in pp collisions at a energy-of-centre of mass of 13 TeV…

2022

This thesis presents a physics analysis performed with the ATLAS detector at the Large Hadron Collider with data from the Run 2 (2015-2018) period of proton-proton collision at a center-of-mass energy of 13 TeV, corresponding to an integrated luminosity used for physics analyses of 139 inverse-fb. The analysis is a search for resonant and non-resonant Higgs boson pair production in the two bottom quarks and two photon final state. Special focus is given to the event selection strategy for the resonant search using multi-variate techniques. In addition, the ATLAS upgrade for the Run 3 (2022-2025) period where the software is migrated to a multi-threading framework is extensively covered alon…

accelerator physicsfísicaPhysics::Instrumentation and Detectors:FÍSICA [UNESCO]UNESCO::FÍSICAHigh Energy Physics::Experimentfísica de altas energíasparticle physicshiggs boson
researchProduct

Comparison between simulated and observed LHC beam backgrounds in the ATLAS experiment at E beam =4 TeV

2018

Results of dedicated Monte Carlo simulations of beam-induced background (BIB) in the ATLAS experiment at the Large Hadron Collider (LHC) are presented and compared with data recorded in 2012. During normal physics operation this background arises mainly from scattering of the 4 TeV protons on residual gas in the beam pipe. Methods of reconstructing the BIB signals in the ATLAS detector, developed and implemented in the simulation chain based on the FLUKA Monte Carlo simulation package, are described. The interaction rates are determined from the residual gas pressure distribution in the LHC ring in order to set an absolute scale on the predicted rates of BIB so that they can be compared qua…

background [beam]background: inducedPhysics::Instrumentation and DetectorsCiencias FísicasMonte Carlo method01 natural sciencesHigh Energy Physics - ExperimentSubatomär fysik//purl.org/becyt/ford/1 [https]High Energy Physics - Experiment (hep-ex)beam lossesSubatomic Physicsscattering [p p][PHYS.HEXP]Physics [physics]/High Energy Physics - Experiment [hep-ex]and programsInstrumentationQCMathematical PhysicsPhysicsLarge Hadron ColliderRadiation calculationsAtlas (topology)Accelerator modelling and simulations (multi-particle dynamics; single-particle dynamics)DetectorATLAS experimentSettore FIS/01 - Fisica SperimentaleSimulation methods and programBeams (radiation) Accelerator modelling and simulations (multi-particle dynamics;; single-particle dynamics); Radiation calculations; Simulation methods; and programs; DETECTOR; SEARCHObservableAccelerator modelling and simulations (multi-particle dynamicMonte Carlo [numerical calculations]ATLASNuclear & Particles PhysicsAccelerator modelling and simulationsCERN LHC Coll collimators beam: backgroundcolliding beams [p p]numerical calculations: Monte CarloCIENCIAS NATURALES Y EXACTASParticle Physics - Experimentp p: scatteringAccelerator modelling and simulations (multi-particle dynamics; Radiation calculations; Simulation methods and programs; single-particle dynamics); Instrumentation; Mathematical Physics530 PhysicsCiências Naturais::Ciências Físicas:Ciências Físicas [Ciências Naturais]FOS: Physical sciencesFísica de Partículas y CamposAccelerator Physics and InstrumentationNuclear physicsFLUKAsingle-particle dynamics)ATLAS LHC High Energy PhysicsHIGH ENERGY PHYSICSSEARCH0103 physical sciencesddc:610010306 general physicsAbsolute scaleDETECTORpressure [gas]Science & Technology010308 nuclear & particles physicsScatteringhep-exRadiation calculationscatteringAcceleratorfysik och instrumentering//purl.org/becyt/ford/1.3 [https]ghostAccelerator modelling and simulations (multi-particle dynamicsSimulation methodscorrelationinduced [background]Experimental High Energy Physicsgas: pressureSimulation methods and programsp p: colliding beamsexperimental results
researchProduct