Search results for "Angiotensin"

showing 10 items of 396 documents

Regulación por estradiol de la producción de Angiotensina 1-7 y papel del receptor Mas en la producción de óxido nítrico en células endoteliales huma…

2017

El sistema renina-angiotensina intracelular (SRA) está formado por un conjunto de enzimas y metabolitos que se han relacionado con la regulación de la función cardiovascular y con la fisiopatología de la hipertensión arterial. El SRA clásico o circulante interviene en la regulación vascular principalmente con los péptidos bioactivos angiotensina (Ang) I y Ang II. La enzima que regula el paso de Ang I a Ang II es la enzima de conversión de la angiotensina 1 (ECA-1, la primera que se describió). En el año 2000 se descubrió que la enzima de conversión de la angiotensina 2 (ECA-2) convertía la Ang II en Ang 1-7. La Ang 1-7 es una molécula del SRA que tiene efecto fundamentalmente vasodilatador.…

enzima convertidora de angiotensinaestrógenoscélulas endotelialessistema renina angiotensinareceptores de estrógenos
researchProduct

Endocrine effects of sauna bath

2020

Sauna bath brings about numerous acute changes in hormone levels, partly akin to other stressful situations, partly specific for sauna. Norepinephrine increases in those accustomed to sauna bath. Sweating increases the production of antidiuretic hormone, and the renin-angiotensin system becomes activated. Of the anterior pituitary hormones, growth hormone (GH) and prolactin (PRL) secretion is increased. Also β-endorphin has been frequently reported to increase, whereas the responses of ACTH and cortisol are variable, probably depending on the type of sauna exposure. Sperm production decreases in particular in sauna-naïve men, but reduced fertility has not been associated with regular sauna …

growth hormone (GH)sopeutuminenendorfiinitsaunominenkasvuhormonitβ-endorphinadaptationcortisolhyperthermiahot bathspermatogenesisnorepinephrinerenin-angiotensinheat stresshydrokortisoniprolactin (PRL)terveysvaikutuksetprolaktiinilämpötilahypertermianoradrenaliinikuumuus
researchProduct

ROLE OF RENIN-ANGIOTENSIN SYSTEM IN COLONIC DYSMOTILITY ASSOCIATED WITH BOWEL INFLAMMATION IN RATS

2015

Dysregulation of different mediator systems could contribute to the gut dismotility in inflammatory bowel diseases (IBDs), chronic disorders characterized by an exasperated immune response disturbing gut functions. Among these, Angiotensin II (Ang II), the main peptide of renin-angiotensin system (RAS), can participate in inflammatory responses and RAS components are increased in IBD patients. Since RAS has emerged as gut motility regulator, our objectives was to investigate, in an IBD rat model, the RAS functionality and its eventual contribution to colonic dismotility. Experimental colitis was induced in rats by intracolonic administration of 2,4-dinitrobenzenesulfonic acid (DNBS). Drug e…

inflammatory bowel disease colon angiotensinSettore BIO/09 - Fisiologia
researchProduct

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct

Changes of plasma endothelin and growth factor levels, and of left ventricular mass, after chronic AT1-receptor blockade in human hypertension.

1998

The stimulation of autocrine and paracrine factors such as basic fibroblast- (bFGF) and platelet-derived (PDGF) growth factors mediates many of the growth-promoting actions of angiotensin II. The aim of this study was to evaluate the effect of chronic AT1-receptor blockade on plasma endothelin-1 (ET-1) and growth factors levels, and on left ventricular mass, in essential hypertension (EH). The study population consisted of 16 patients with mild-moderate EH, and 25 normotensive controls. In the EH patients under basal conditions, and after 3 and 6 months of chronic therapy with Losartan 50 mg/day, we measured serum levels of ET-1, bFGF and PDGF, and tumor necrosis factor (TNF). At the same t…

medicine.hormoneAdultMalemedicine.medical_specialtyAngiotensin receptorAmbulatory blood pressureHeart VentriclesEssential hypertensionLosartanEndothelinsAngiotensin Receptor AntagonistsInternal medicineBlood plasmaInternal MedicineMedicineHumansGrowth SubstancesAntihypertensive Agentsbusiness.industryEndothelinsMyocardiummedicine.diseaseAngiotensin IILosartanBlood pressureEndocrinologyChronic DiseaseHypertensionFemalebusinessmedicine.drugAmerican journal of hypertension
researchProduct

Does the renin-angiotensin system also regulate intra-ocular pressure?

2009

The renin-angiotensin-aldosterone system is known to play an essential role in controlling sodium balance and body fluid volumes, and thus blood pressure. In addition to the circulating system which regulates urgent cardiovascular responses, a tissue-localized renin-angiotensin system (RAS) regulates long-term changes in various organs. Many recognized RAS components have also been identified in the human eye. The highly vasoconstrictive angiotensin II (Ang II) is considered the key peptide in the circulatory RAS. However, the ultimate effect of RAS activation at tissue level is more complex, being based not only on the biological activity of Ang II but also on the activities of other produ…

medicine.medical_specialty030204 cardiovascular system & hematologyPeptide hormoneRenin-Angiotensin System03 medical and health sciences0302 clinical medicineInternal medicineRenin–angiotensin systemMedicineAnimalsHumansIntraocular Pressurebiologybusiness.industryAngiotensin-converting enzymeBiological activityGeneral MedicineWater-Electrolyte BalanceAngiotensin IIBiosynthetic PathwaysBlood pressureEndocrinologyACE inhibitorCirculatory system030221 ophthalmology & optometrybiology.proteinOcular Hypertensionbusinessmedicine.drugAnnals of medicine
researchProduct

An epidemiological study exploring a possible impact of treatment with ACE inhibitors or angiotensin receptor blockers on ACE2 plasma concentrations

2020

medicine.medical_specialty2019-20 coronavirus outbreakCoronavirus disease 2019 (COVID-19)business.industrySevere acute respiratory syndrome coronavirus 2 (SARS-CoV-2)COVID-19Angiotensin-Converting Enzyme InhibitorsPharmacologyPolymorphism Single NucleotideAngiotensin Receptor AntagonistsEpidemiologic StudiesRisk FactorsEpidemiologyPlasma concentrationmedicineHumansAngiotensin-Converting Enzyme 2Angiotensin Receptor BlockersCardiology and Cardiovascular MedicinebusinessMolecular BiologyJournal of Molecular and Cellular Cardiology
researchProduct

Spectrum of mutations in the renin-angiotensin system genes in autosomal recessive renal tubular dysgenesis

2012

Autosomal recessive renal tubular dysgenesis (RTD) is a severe disorder of renal tubular development characterized by early onset and persistent fetal anuria leading to oligohydramnios and the Potter sequence, associated with skull ossification defects. Early death occurs in most cases from anuria, pulmonary hypoplasia, and refractory arterial hypotension. The disease is linked to mutations in the genes encoding several components of the renin-angiotensin system (RAS): AGT (angiotensinogen), REN (renin), ACE (angiotensin-converting enzyme), and AGTR1 (angiotensin II receptor type 1). Here, we review the series of 54 distinct mutations identified in 48 unrelated families. Most of them are no…

medicine.medical_specialty2716 Genetics (clinical)10039 Institute of Medical GeneticsAngiotensinogen030232 urology & nephrologyGenes RecessivePrenatal diagnosis610 Medicine & healthPeptidyl-Dipeptidase ABiologymedicine.disease_causeReceptor Angiotensin Type 1Kidney Tubules ProximalRenin-Angiotensin System03 medical and health sciences0302 clinical medicine1311 GeneticsInternal medicineReninRenin–angiotensin systemGeneticsmedicineAnimalsHumansGenetic Association StudiesGenetics (clinical)030304 developmental biology0303 health sciencesKidneyMutationAngiotensin II receptor type 1medicine.disease3. Good healthDisease Models Animalmedicine.anatomical_structureEndocrinologyUrogenital AbnormalitiesRenal blood flowMutation570 Life sciences; biologyAnuriamedicine.symptomPotter sequence
researchProduct

Tagesprofile von Plasmaaldosteron,-Cortisol, -Renin, -Angiotensinogen und -Angiotensinasen bei Normalpersonen

1976

Plasma cortisol and renin were estimated in 1 h intervals, plasma aldosterone, angiotensinogen and angiotensinases in 3 h intervals over periods of 24 h in six normal volunteers (age 20-26) under control conditions and subsequently under suppression of ACTH release by dexamethasone. Highest cortisol levels were found around 7 a.m., minimum levels between 9 p.m. and 1 a.m. Dexamethasone reduced cortisol to constantly low concentrations. Aldosterone was highest around 4 a.m. under control conditions and under dexamethasone, and showed lowest concentrations between 4 and 10 p.m. There were no significant differences between mean aldosterone concentrations at corresponding time points of the co…

medicine.medical_specialtyAldosteroneGeneral MedicineAdrenocorticotropic hormonechemistry.chemical_compoundEndocrinologychemistryInternal medicineDrug DiscoveryRenin–angiotensin systemmedicineMolecular MedicineCircadian rhythmCortisoneCortisol levelGenetics (clinical)DexamethasoneVolume concentrationmedicine.drugKlinische Wochenschrift
researchProduct

Changes of Angiotensin Converting Enzyme (Ace) Levels During Activation of the Renin-Angiotensin-Aldosterone System (RAAs)

1987

The aim of this study was to evaluate the changes of ACE levels during RAAs activation induced by: 1) a continuous graded bicycle ergometer test performed in a group of 15 males health youths aged between 21 and 30 years, with average age of 25.8 +/- 2.85 years; 2) i.m. injection of 20 mg of frusemide in 11 health youths (10 males and 1 female), aged between 20 and 30 years, with average age of 24.09 +/- 2.77 years; 3) dialytic treatment in 25 patients (12 males and 13 females), suffering from chronic renal failure, aged between 26 and 68 years, with average age of 54 +/- 15.42 years. Plasmatic renin activity (PRA), aldosterone (ALD) and ACE levels were determined by RIA in basal conditions…

medicine.medical_specialtyAldosteronebiologybusiness.industrymedicine.medical_treatmentAngiotensin-converting enzymePlasma renin activityBasal (phylogenetics)chemistry.chemical_compoundEndocrinologychemistryInternal medicineRenin–angiotensin systembiology.proteinMedicineChronic renal failureBicycle ergometerbusinessDialysis
researchProduct