Search results for "Cost effectivene"

showing 10 items of 115 documents

Kosteneffektivitätsanalyse der Versorgung von Kataraktpatienten mit monofokalen Intraokularlinsen aus Sicht der Leistungserstatter

2003

BACKGROUND Data on the cost effectiveness of cataract surgery with respect to the German statutory health insurance system are hardly available. Hence the increase in visual acuity as primary efficacy endpoint, order of posterior capsule opacification as primary complication endpoint and direct cost for supplementation with monofocal intraocular lenses have been assessed via meta-analyses to evaluate the procedure's cost effectiveness from the perspective of the German statutory health insurance system. MATERIAL AND METHODS Using the medical internet database MEDLINE two meta-analyses on publications between 1995 and 2002 were carried out, one estimating the gained increase in visual acuity…

Visual acuitygenetic structuresCost effectivenessbusiness.industrymedicine.medical_treatmentEye diseaseOutpatient surgeryIntraocular lensCataract surgerymedicine.diseaseeye diseasesOphthalmologyInterquartile rangeMedicineOptometrymedicine.symptombusinessIncremental cost-effectiveness ratioKlinische Monatsblätter für Augenheilkunde
researchProduct

Financial Aspects of Cervical Disc Arthroplasty: A Narrative Review of Recent Literature

2020

Recently, there has been significant interest in understanding the cost-effectiveness of treatments in spine surgery as health care systems in the United States move toward value-based care and alternative payment models. Previous studies have shown comparable outcomes of cervical disc arthroplasty (CDA) and anterior cervical discectomy fusion; however, there is a lack of consensus on the cost-effectiveness of CDA to support full adoption. Evidence of the limitations of these cost-analysis studies also exists in the literature, including industry funding, potential selection bias, and varying methods of calculating value. The goal of this narrative review is to provide an overview of the co…

cervical disc arthroplastyTotal Disc Replacementmedicine.medical_specialtyCost effectivenessCost-Benefit Analysismedia_common.quotation_subjectmedicine.medical_treatmentAnterior cervical discectomy and fusionIntervertebral Disc Degeneration03 medical and health sciences0302 clinical medicineSpine surgeryHealth careHumansMedicinePatient Reported Outcome MeasuresRadiculopathyIntensive care medicinecost-effectivenesshealth care economics and organizationsmedia_commonSelection biasbusiness.industryArthroplastyUnited StatesSpinal Fusioncost-analysis studie030220 oncology & carcinogenesisCervical VertebraeCosts and Cost AnalysisSurgeryNarrative reviewQuality-Adjusted Life YearsNeurology (clinical)businessCervical discSpinal Cord Compression030217 neurology & neurosurgeryanterior cervical discectomy and fusionDiskectomy
researchProduct

Modeling cost-effectiveness and health gains of a “universal” versus “prioritized” hepatitis C virus treatment policy in a real-life cohort

2017

We evaluated the cost-effectiveness of two alternative direct-acting antiviral (DAA) treatment policies in a real-life cohort of hepatitis C virus–infected patients: policy 1, “universal,” treat all patients, regardless of fibrosis stage; policy 2, treat only “prioritized” patients, delay treatment of the remaining patients until reaching stage F3. A liver disease progression Markov model, which used a lifetime horizon and health care system perspective, was applied to the PITER cohort (representative of Italian hepatitis C virus–infected patients in care). Specifically, 8,125 patients naive to DAA treatment, without clinical, sociodemographic, or insurance restrictions, were us…

hepatitis C virusPediatricsCost effectivenessViral HepatitisAdult; Aged; Aged 80 and over; Antiviral Agents; Cohort Studies; Cost-Benefit Analysis; Health Policy; Hepatitis C; Humans; Middle Aged; Young Adult; Models Economic; HepatologyCost-Benefit AnalysisDirect-acting antiviralAdult; Aged; Aged 80 and over; Antiviral Agents; Cohort Studies; Cost-Benefit Analysis; Health Policy; Hepatitis C; Humans; Middle Aged; Young Adult; Models EconomicCohort StudiesLiver disease0302 clinical medicineModelsHealth careantiviral therapy80 and overincremental cost-effectiveness ratiohealth care economics and organizationsHCV cost -effectivenessAged 80 and overDirect-acting antiviral hepatocellular carcinoma hepatitis C virus incremental cost-effectiveness ratio interferon quality-adjusted life-years sustained virological response willingness to payCost–benefit analysis030503 health policy & servicesquality-adjusted life-yearsHealth PolicyHepatitis Chepatocellular carcinomainterferonMiddle AgedHepatitis CModels EconomicAdult; Aged; Aged 80 and over; Antiviral Agents; Cohort Studies; Cost-Benefit Analysis; Health Policy; Hepatitis C; Humans; Middle Aged; Young Adult; Models Economic; Hepatology; HCV; antiviral therapy; cost-effectiveness; real-life cohortCohortHCV030211 gastroenterology & hepatologyOriginal Articlesustained virological response0305 other medical scienceCohort studyHumanAdultmedicine.medical_specialtyEconomicAntiviral AgentsNO03 medical and health sciencesYoung Adultreal-life cohortmedicineHumansCost-Benefit Analysicost-effectivenessHealth policyAgedAntiviral AgentHepatologybusiness.industryOriginal Articlesmedicine.diseaseSurgeryCohort Studiebusinesswillingness to pay
researchProduct

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct

Cost Effectiveness of Peginterferon ??-2a Plus Ribavirin versus Interferon ??-2b Plus Ribavirin as Initial Therapy for Treatment-Naive Chronic Hepati…

2004

Introduction: In adults with previously untreated chronic hepatitis C (CHC), the combination of peginterferon α-2a plus ribavirin produces a higher rate of sustained virological response (SVR) than interferon α-2b plus ribavirin, but it is still unproven whether this increase is cost effective. The objective of this study was to determine if the gain in SVR with peginterferon α-2a plus ribavirin is worth the incremental cost. Methods: We constructed a Markov model of disease progression in which cohorts of patients received peginterferon α-2a plus ribavirin or interferon α-2b plus ribavirin for 48 weeks (hepatitis C virus [HCV] genotype 1 and non-1 patients with fibrosis) or 24 weeks (genot…

medicine.medical_specialtyCirrhosisGenotypeCost effectivenessCost-Benefit AnalysisHepatitis C virusInterferon alpha-2medicine.disease_causeAntiviral AgentsSensitivity and SpecificityGastroenterologypeginterferon alpha2aPolyethylene Glycolschemistry.chemical_compoundchronic hepatitiInterferonInternal medicineRibavirinmedicineHumansRandomized Controlled Trials as Topicalpha2b interferonAntiviral AgentPharmacologybusiness.industryHealth PolicyRibavirinPublic Health Environmental and Occupational HealthInterferon-alphavirus diseasesHealth Care CostsHepatitis CHepatitis C Chronicmedicine.diseaseMarkov ChainsRecombinant Proteinsdigestive system diseasesModels EconomicTreatment OutcomechemistryImmunologyQuality of LifePeginterferon alfa-2bDrug Therapy CombinationbusinessPeginterferon alfa-2amedicine.drugPharmacoEconomics
researchProduct

Cost-effectiveness of sofosbuvir-based triple therapy for untreated patients with genotype 1 chronic hepatitis C

2014

We assessed the cost-effectiveness of sofosbuvir (SOF)-based triple therapy (TT) compared with boceprevir (BOC)- and telaprevir (TVR)-based TT in untreated genotype 1 (G1) chronic hepatitis C (CHC) patients discriminated according to IL28B genotype, severity of liver fibrosis, and G1 subtype. The available published literature provided the data source. The target population was made up of untreated Caucasian patients, aged 50 years, with G1CHC and these were evaluated over a lifetime horizon by Markov model. The study was carried out from the perspective of the Italian National Health Service. Outcomes included discounted costs (in euros at 2013 value), life-years gained (LYG), quality-adju…

medicine.medical_specialtyCirrhosisHepatologySofosbuvirCost effectivenessbusiness.industryHepatologymedicine.diseaseSurgeryQuality-adjusted life yearTelaprevirchemistry.chemical_compoundTolerabilitychemistryBoceprevirInternal medicinemedicinebusinesshealth care economics and organizationsmedicine.drugHepatology
researchProduct

Cost-effectiveness of screening for colorectal cancer in France using a guaiac test versus an immunochemical test

2010

Objectives: The aim of this study was to compare the cost and the effectiveness of two biennial fecal occult blood screening tests for colorectal cancer: a guaiac nonrehydrated test (G-FOBT) and an immunochemical test (I-FOBT) with the absence of screening.Methods: A Markov model was developed to compare these strategies in a general population of subjects aged 50 to 74 over a 20-year period.Results: Compared with the absence of screening, G-FOBT and I-FOBT were associated with a decrease in colorectal cancer mortality of 17.4 percent and 25.2 percent, respectively. With regard to cost-effectiveness, expressed as cost per life-year gained, I-FOBT was the most effective and most costly alter…

medicine.medical_specialtyColorectal cancerCost effectivenessCost-Benefit Analysishealth care facilities manpower and serviceseducationPopulationImmunologic TestsSensitivity and SpecificityInternal medicinemedicineHumansMass ScreeningeducationSensitivity analyseshealth care economics and organizationsMass screeningAgedGynecologyeducation.field_of_studybiologybusiness.industryHealth PolicyEurosMiddle Agedmedicine.diseasebiology.organism_classificationMarkov Chainsdigestive system diseasesTest (assessment)surgical procedures operativeFecal occult blood screeningOccult BloodIndicators and ReagentsFranceColorectal NeoplasmsGuaiacbusinessInternational Journal of Technology Assessment in Health Care
researchProduct

Update on cardiovascular prevention in clinical practice: A position paper of the European Association of Preventive Cardiology of the European Socie…

2020

This is a pre-copyedited, author-produced version of an article accepted for publication in European Journal of Preventive Cardiology following peer review. The version of record Piepoli, M.F., Abreu, A., Albus, C., Ambrosetti, M., Brotons, C., Catapano, A.L. ... Tiberi, M. (2020). Update on cardiovascular prevention in clinical practice: A position paper of the European Association of Preventive Cardiology of the European Society of Cardiology*. European Journal of Preventive Cardiology (EJPC), 27(2), 181-205 is available online at: https://doi.org/10.1177/2047487319893035. European guidelines on cardiovascular prevention in clinical practice were first published in 1994 and have been regu…

medicine.medical_specialtyConsensusEpidemiologyCost effectivenessCost-Benefit AnalysisPopulationCardiologyPsychological interventionphysical activitypopulationGuidelinesrisk managementsmokingrehabilitationlipidsprimary carepreventionhealthy lifestyleInternal medicinePreventive Health ServicesEpidemiologyHumansMedicineguidelineseducationpsychosocial factorsstakeholderRisk managementeducation.field_of_studyVDP::Medisinske Fag: 700::Helsefag: 800::Samfunnsmedisin sosialmedisin: 801diabetesbusiness.industryStakeholderblood pressurerisk assessmentHealth Care CostsProtective FactorsPrognosisnutritionCardiovascular DiseasesHeart Disease Risk FactorsCardiologyPosition paperCardiology and Cardiovascular MedicinebusinessRisk assessmentclinical settings
researchProduct

A Systematic Review of Cost-effectiveness Evidence of Endoscopic Saphenous Vein Harvesting: Is it Efficient?

2011

Objective: Greater saphenous vein harvest for coronary and lower extremity bypass requires the longest incision of any surgical procedure. Endoscopic vein harvest allows better results in some clinical variables compared to open harvesting techniques. The objec- tive of this study is to present the results of a systematic review of the scientific evidence about the efficiency of endoscopic saphenous vein harvest. Methods: We performed a systematic review in the bibliographical databases Pubmed, National Health Service Economic Evaluation Database, and NHS Health Technology Assess- ment Database. The search strategy was "endoscopic AND harvesting", in the period January 1970eDecember 2009. R…

medicine.medical_specialtyCost effectivenessCost-Benefit AnalysisGreater saphenous veinEfficiencyScientific evidenceVein harvestingmedicineEconomic evaluation databaseHumansSaphenous VeinEndoscopic harvestMedicine(all)business.industryGeneral surgeryHealth technologyEndoscopyEconomic evaluationSurgeryEconomic evaluationVein harvestTissue and Organ HarvestingSurgerybusinessCardiology and Cardiovascular MedicineVascular Surgical ProceduresEuropean Journal of Vascular and Endovascular Surgery
researchProduct

Optimization of hepatitis C virus screening strategies by birth cohort in Italy

2020

Abstract Background and Aims Cost‐effective screening strategies are needed to make hepatitis C virus (HCV) elimination a reality. We determined if birth cohort screening is cost‐effective in Italy. Methods A model was developed to quantify screening and healthcare costs associated with HCV. The model‐estimated prevalence of undiagnosed HCV was used to calculate the antibody screens needed annually, with a €25 000 cost‐effectiveness threshold. Outcomes were assessed under the status quo and a scenario that met the World Health Organization's targets for elimination of HCV. The elimination scenario was assessed under five screening strategies. Results A graduated birth cohort screening strat…

medicine.medical_specialtyCost effectivenessCost-Benefit AnalysisHepatitis C virusSettore SECS-P/06cost-effectiveneHepacivirusmedicine.disease_causeAntiviral AgentsWorld healthNO03 medical and health sciences0302 clinical medicineInternal medicinemedicineHumansMass Screeningcost-effectivenessAntibody screensHepatologyUnder-fivebusiness.industryscreeningHealth services researchhealthcost‐effectivenessHepatitis C ChronicHepatologyHepatitis CItaly030220 oncology & carcinogenesisSettore MED/42HCVOriginal Articleepidemiology030211 gastroenterology & hepatologyLiver Disease and Public HealthQuality-Adjusted Life YearsBirth cohortbusinessWHO targetscost-effectiveness HCV screening WHO targetsDemography
researchProduct