Search results for "Cost-effectivene"

showing 10 items of 76 documents

Energy redevelopment of historical centres in the pursuance of the cost-effectiveness principle

2016

In historical centres the search for architectural and plant design solutions for the achievement of higher energy and environmental performances of buildings has to reconcile the preservation of the peculiarities of the building stock on the one hand and the economic efficiency of the interventions on the other one. The cost-effectiveness principle, which is adopted by European policies for the improvement of energy performances of the building stock, may be satisfied through the use of specific macro and micro-economic valuation models.

historic centreoperational model.cost-effectiveneSettore ICAR/22 - Estimoenergy redevelopment
researchProduct

First-Line Treatments for Extensive-Stage Small-Cell Lung Cancer With Immune Checkpoint Inhibitors Plus Chemotherapy: A Network Meta-Analysis and Cos…

2022

BackgroundImmune checkpoint inhibitors (ICIs) plus chemotherapy were unlikely to be considered cost-effective compared with chemotherapy as the first-line treatment of patients with extensive-stage small-cell lung cancer (ES-SCLC) in China due to its high costs. However, the cost-effectiveness of the comparison between the regimens of ICIs plus chemotherapy were remained unclear yet. The aim of this study was to evaluate the efficacy and cost-effectiveness of ICIs plus chemotherapy as the first-line treatment for ES-SCLC from the perspective of the Chinese healthcare system.MethodsA network meta-analysis (NMA) was conducted to indirect compare the clinical benefits between the ICIs plus che…

immune checkpoint inhibitorsCancer ResearchOncologyNeoplasms. Tumors. Oncology. Including cancer and carcinogenschemotherapyextensive-stage small-cell lung cancercost-effectivenessfirst-line treatmenthealth care economics and organizationsRC254-282Original ResearchFrontiers in Oncology
researchProduct

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct

Kontrollikuutio : riskipainotettu kustannusvaikuttavuuden analyysi- ja johtamismalli kunnallisessa perusterveydenhuollossa

2020

There have been calls for cost-effective public services and the integration of management control and risk management systems. Municipalities currently need to consider aging populations and diminishing financial resources. But municipal services may also include other risks, such as reputational and political risks, along with changes in legislation as well as unexpected changes in operating circumstances. Risks and how they are managed affect both the costs and the effectiveness of municipal services. However, cost-effectiveness and risks are not clear-cut concepts, especially in the public health services. Therefore, in order to better understand risks in public sector management contro…

management control systemArtikkelitterveydenhoitocost-effectivenessjulkinen sektoririsk
researchProduct

Optimization of hepatitis C virus screening strategies by birth cohort in Italy

2020

Abstract Background and Aims Cost‐effective screening strategies are needed to make hepatitis C virus (HCV) elimination a reality. We determined if birth cohort screening is cost‐effective in Italy. Methods A model was developed to quantify screening and healthcare costs associated with HCV. The model‐estimated prevalence of undiagnosed HCV was used to calculate the antibody screens needed annually, with a €25 000 cost‐effectiveness threshold. Outcomes were assessed under the status quo and a scenario that met the World Health Organization's targets for elimination of HCV. The elimination scenario was assessed under five screening strategies. Results A graduated birth cohort screening strat…

medicine.medical_specialtyCost effectivenessCost-Benefit AnalysisHepatitis C virusSettore SECS-P/06cost-effectiveneHepacivirusmedicine.disease_causeAntiviral AgentsWorld healthNO03 medical and health sciences0302 clinical medicineInternal medicinemedicineHumansMass Screeningcost-effectivenessAntibody screensHepatologyUnder-fivebusiness.industryscreeningHealth services researchhealthcost‐effectivenessHepatitis C ChronicHepatologyHepatitis CItaly030220 oncology & carcinogenesisSettore MED/42HCVOriginal Articleepidemiology030211 gastroenterology & hepatologyLiver Disease and Public HealthQuality-Adjusted Life YearsBirth cohortbusinessWHO targetscost-effectiveness HCV screening WHO targetsDemography
researchProduct

HCV eradication: a duty of the State, an option for the individual

2020

In recent years, the debate on ethical issues related to hepatitis C virus therapies has been focused on the problem of drug prices and access to therapies. Nonetheless, the goal of hepatitis C virus eradication set by the World Health Organization in 2016 is raising new ethical issues, since governments are faced with a new challenge: reaching through screening, diagnosis and treatment a large amount of subjects with undiagnosed hepatitis C infection. National governments, especially high-income countries with a Welfare State, are compelled to provide access to therapies, but also to involve those who are still unaware of their disease status. Since people cannot be forced but should be gu…

medicine.medical_specialtyCost effectivenessmedia_common.quotation_subjectHepatitis C virusmedicine.disease_causeSettore MED/02 - Storia Della Medicina03 medical and health sciences0302 clinical medicineState (polity)Settore MED/43 - Medicina Legalemedicinehcv030212 general & internal medicineEthicIntensive care medicineDutyAutonomymedia_commonEradicationEthical issuesbusiness.industryWelfare stateHepatitis Cmedicine.diseaseCost-effectivenessbusinessAutonomy
researchProduct

Cost effectiveness analysis of childhood obesity primary prevention programmes: a systematic review

2022

Background. Childhood obesity is associated with enormous health consequences and costs to society. This study aims to systematically review the studies on Cost Effectiveness Analysis (CEA) of primary prevention programmes of childhood obesity, discussing the gaps and providing recommendations for future research. Methods. All the studies on the cost effectiveness evaluation of primary prevention of obesity among children were included. Studies were retrieved from MEDLINE and Google Scholar, up to 31st March 2012, with only English language papers being eligible. The quality of the retrieved studies was evaluated by using the Drummond scale. Re…

medicine.medical_specialtyCost effectivenessprimary preventionAlternative medicineMEDLINEsystemic reviewOverweightSettore MED/42 - Igiene Generale E ApplicataChildhood obesityIntervention (counseling)medicineoverweightcost-effectivenesslcsh:R5-920business.industrylcsh:Public aspects of medicinelcsh:RA1-1270Cost-effectiveness analysismedicine.diseaseScale (social sciences)Family medicinePhysical therapymedicine.symptombusinesslcsh:Medicine (General)childhood obesitycost-effectiveness childhood obesity overweight primary prevention systemic reviewEpidemiology Biostatistics and Public Health
researchProduct

Closed Incision Negative Pressure Therapy Achieves Better Outcome Than Standard Wound Care: Clinical Outcome and Cost-Effectiveness Analysis in Open …

2020

BackgroundSurgical site infections (SSIs) and surgical site occurrences (SSOs) are frequent post-operative complications that are dependent on the presence of different risk factors. The use of closed incision negative pressure therapy (ciNPT) is considered a measure by the WHO guidelines for prevention of SSIs. The prevention of SSOs is an extremely important issue in the ventral hernia repair (VHR) surgical field. SSO onset not only affects the patient's quality of life, but can also cause the onset of life-threatening conditions that may require re-hospitalization, re-intervention and often mesh removal. Such outcome can become extremely costly, contributing to increased health care cost…

medicine.medical_specialtyCost effectivenessventral hernia repair030204 cardiovascular system & hematology03 medical and health sciencesWound care0302 clinical medicineQuality of lifeEpidemiologyMedicineguidelinescost-effectivenesssurgical site occurrencesbusiness.industryMedical recordGeneral Engineeringsurgical site infectionsCost-effectiveness analysisabdominal surgeryQuality ImprovementSurgeryRelative riskGeneral Surgeryoutcomeclosed incision negative pressure therapyPreventive Medicinebusiness030217 neurology & neurosurgeryAbdominal surgery
researchProduct

Cost-effectiveness analysis of robot-assisted vs. open partial nephrectomy

2017

Background The cost-effectiveness of robot-assisted partial nephrectomy (RAPN) vs. the open procedure is not established. Methods We estimated in-hospital complications and the cost of RAPN vs. open partial nephrectomy (OPN) using an economic model. Costs incurred both intraoperatively and in hospital were considered. US data were extracted from existing literature. Results Mean in-hospital costs were $14,824 (95% CI $13,368-$16,898) for RAPN and $15,094 (95% CI $13,491-$17,140) for OPN. Complications after RAPN occurred in 23.3% (95% CI 20.0-25.8%) and after OPN in 36.1% (95% CI 35.6-36.6%) of the patients. In a sensitivity analysis, limited centre experience was associated with relevant i…

medicine.medical_specialtyCost-Benefit Analysismedicine.medical_treatment030232 urology & nephrologyBiophysicsNephrectomy03 medical and health sciencesPostoperative Complications0302 clinical medicineRobotic Surgical ProceduresmedicineHumansOpen partial nephrectomyHospital CostsComputer-assisted surgerybusiness.industryDecision TreesPerioperativeCost-effectiveness analysisNephrectomyComputer Science ApplicationsSurgeryModels EconomicTreatment Outcome030220 oncology & carcinogenesisSurgeryLower costbusinessThe International Journal of Medical Robotics and Computer Assisted Surgery
researchProduct

Cost-effectiveness of bedaquiline in MDR and XDR tuberculosis in Italy

2016

ABSTRACT Objective: To evaluate the cost-effectiveness of bedaquiline plus background drug regimens (BR) for multidrug-resistant tuberculosis (MDR-TB) and extensively drug-resistant tuberculosis (XDR-TB) in Italy. Methods: A Markov model was adapted to the Italian setting to estimate the incremental cost-effectiveness ratio (ICER) of bedaquiline plus BR (BBR) versus BR in the treatment of MDR-TB and XDR-TB over 10 years, from both the National Health Service (NHS) and societal perspective. Cost-effectiveness was evaluated in terms of life-years gained (LYG). Clinical data were sourced from trials; resource consumption for compared treatments was modelled according to advice from an expert c…

medicine.medical_specialtyPediatricsTuberculosisCost effectivenessBedaquilinelcsh:Business03 medical and health scienceschemistry.chemical_compound0302 clinical medicineSocietal perspectivemedicineOriginal Research Article030212 general & internal medicineResource consumptionSensitivity analysescost-effectivenessDisease treatmenthealth care economics and organizationsbusiness.industrylcsh:Public aspects of medicinelcsh:RA1-1270medicine.diseaseNational health serviceMDR tuberculosis030228 respiratory systemchemistryItalyEmergency medicineXDR tuberculosisOriginal ArticleBedaquilinebusinesslcsh:HF5001-6182Journal of Market Access & Health Policy
researchProduct