Search results for "Effective"

showing 10 items of 1371 documents

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct

"Legislative Inflation" - An analysis of the Phenomenon in Contemporary Legal Discourse

2011

legal nihilismSociology and Political ScienceLegal pluralismeffectiveness of lawlegislative inflationKeuropean legal developmentLegal researchLegal realismLawPolitical scienceLegal opinionPhilosophy of lawEmpirical legal studiessymbolic lawsLegal nihilismLegal professionLawBaltic Journal of Law & Politics
researchProduct

Life Skills e formazione iniziale dei docenti

2022

challenges of everyday life. Learning to live involves acquiring many skills, for which in some cases there is a natural predisposition, but which always require a "guided" exercise in real life contexts so that the person acquires the skills necessary to "live properly". The research was conducted with a group of 153 students from the Master of Science in Primary Education, who participated in a two-year training project during the academic years 2020-21 and 2021-22. This article describes whether and to what extent the students believe they have developed the four chosen life skills and which of the training methodologies adopted by the lecturers were most effective.

life skills growth awareness sustainable skills effective methodologiesSettore M-PED/03 - Didattica E Pedagogia Speciale
researchProduct

Headmaster-teacher relationship in leading school

2013

The study explored principal-teacher relationships in four Junior High schools in the Sekyere South District of Ashanti in Ghana. One of the things that government, policy-makers and educators in Ghana rarely or never discuss is the value and significance of human connections - the relationships in schools. The focus of the study was to uncover the significance of developing and sustaining a high-quality relationship between principals and teachers for effective leadership and performance. Again, the study projects a broader conception of leadership, one that shifts away from the traditional thinking approach where the figure-head is seen as ultimately responsible for the school outcomes, t…

luottamusesimies-alaissuhdeLeader-Member exchange theorykouluand Leadership participation.The value of trust in professional relationshipshenkilösuhteetopettajatrehtoritProfessional relationshipsjohtajuusEffective leadership role
researchProduct

Kontrollikuutio : riskipainotettu kustannusvaikuttavuuden analyysi- ja johtamismalli kunnallisessa perusterveydenhuollossa

2020

There have been calls for cost-effective public services and the integration of management control and risk management systems. Municipalities currently need to consider aging populations and diminishing financial resources. But municipal services may also include other risks, such as reputational and political risks, along with changes in legislation as well as unexpected changes in operating circumstances. Risks and how they are managed affect both the costs and the effectiveness of municipal services. However, cost-effectiveness and risks are not clear-cut concepts, especially in the public health services. Therefore, in order to better understand risks in public sector management contro…

management control systemArtikkelitterveydenhoitocost-effectivenessjulkinen sektoririsk
researchProduct

Local support for conservation is associated with perceptions of good governance, social impacts, and ecological effectiveness

2019

Local support is important for the longevity of conservation initiatives. The literature suggests that perceptions of ecological effectiveness, social impacts, and good governance will influence levels of local support for conservation. This paper examines these relationships using data from a survey of small-scale fishermen in 11 marine protected areas from six countries in the Mediterranean Sea. The survey queried small-scale fishermen regarding perceptions and support for conservation. We constructed composite scores for three categories of perceptions-ecological effectiveness, social impacts, and good governance-and tested the relationship with levels of support using ordinal regression…

management effectivenesocial impactssmall-scale fisheriemarine protected areagood governanceconservationperception
researchProduct

A brief Acceptance and Commitment Therapy intervention for depression : A randomized controlled trial with 3-year follow-up for the intervention group

2018

Abstract Objective This study examined the outcomes of a brief Acceptance and Commitment Therapy (ACT) intervention for depression delivered by novice therapists. Method Participants (N = 115) were randomized either to the brief (six sessions) ACT or to a waitlist control condition (WLC). Outcomes were assessed with diagnoses of depressive episodes (ICD-10) and questionnaires. Results After the 6-week intervention, diagnostic remission rates were 60% in the ACT and 22% in the control group. Further, 70% of the ACT participants were classified as either recovered or improved. The post-measurement between-group effect size for depression symptoms was large and favored the ACT group (BDI-II, d…

masennus050103 clinical psychologyOrganizational Behavior and Human Resource Managementmedicine.medical_specialtyHealth (social science)hyväksymis- ja omistautumisterapiaeffectivenessIntervention groupAcceptance and commitment therapylaw.invention03 medical and health sciencesBehavioral Neuroscience0302 clinical medicineRandomized controlled trialbrief interventionslawIntervention (counseling)medicine0501 psychology and cognitive sciencesAcceptance and Commitment TherapyApplied PsychologyEcology Evolution Behavior and SystematicsDepression (differential diagnoses)ta51505 social sciencesnovice therapists030227 psychiatry3. Good healthlyhytterapiadepressionPhysical therapyPsychologyJournal of Contextual Behavioral Science
researchProduct

Masennuksen pariterapian vaikuttavuuden erot tutkimusyksiköiden välillä ja niitä välittävät tekijät

2013

Tutkimuksen tarkoituksena oli selvittää masennuksen pariterapian vaikuttavuuden eroja tutkimusyksiköiden välillä ja niitä välittäviä tekijöitä. Näitä tavoitteita varten tutkittiin myös, onko pariterapia vaikuttavaa masennuksen hoidossa. Tutkimusyksiköiden välisiä eroja pariterapian tuloksellisuudessa on tutkittu vain vähän. Lisäksi tekijöitä, jotka välittävät tutkimusyksiköiden välisiä eroja masennuksen pariterapian tuloksellisuudessa ei ole ilmeisesti tutkittu. Kuitenkin masennuksen pariterapian tuloksellisuutta on tutkittu ja sen on todettu olevan tuloksellista (Kung, 2000). Tässä tutkimuksessa tarkasteltiin Länsi-Pohjan ja Pohjois-Savon tutkimusyksiköiden välisiä eroja masennuksen hoidon…

masennusvälittävät tekijät; couple therapydepressioneffectivenesspariterapiamediating factorsvaikuttavuusdifferences between research unitstutkimusyksiköiden väliset erot
researchProduct

Enablers and Constraints of STEM Programme Implementation: an External Change Agent Perspective from a National STEM Programme in Finland

2021

AbstractAn international need exists for effective programmes that will enhance learners’ interest in studies and careers related to science, technology, engineering and mathematics, i.e. STEM. When considering the impact of STEM programmes, it is important to identify what can enable or constrain effective programme implementation. As such, enablers can be systematically supported and constraints tackled to maximise a programme’s impact. This study considers a nationwide STEM programme in Finland that involved 450 teachers and their learning communities. The study followed an interpretative paradigm, collecting data through semi-structured interviews and analysed with data-driven thematic …

matematiikkaoppiminenluonnontieteetGeneral MathematicsprogrammeeffectivenessSTEMvaikuttavuusopettajatoppilaatEducationohjelmat (suunnitelmat)koulutussuunnittelutekniikka (tieteet)constraintsarviointienablersInternational Journal of Science and Mathematics Education
researchProduct

“Thanks for Watching.” The Effectiveness of YouTube vlogendorsements

2019

This study examines the effectiveness of brand endorsements in vlogs (video blogs) by assessing the role of audience participation, parasocial relationship, and valence toward vlog endorsements on the perceived credibility of the vlogger and brand attitudes. Four experimental conditions were created on Qualtrics based on a YouTube vlog where the endorser reviewed a few products. The data were collected using Mturk and analyzed with 203 usable responses. The findings indicate that audience participation in the vlog enhances para-social relationship with the vlogger, thus further fostering the vlogger's perceived credibility as an endorser. Additionally, the valence of the audience's attitude…

media_common.quotation_subject050801 communication & media studiesendorser credibilityendorsement effectivenessyleisö0508 media and communicationsArts and Humanities (miscellaneous)PerceptionaudienceCredibilityparticipationValence (psychology)ta518vlogitvalenceAudience participationta512General Psychologyvlogmedia_commonosallistuminen05 social sciences050301 educationPerceived credibilityOnline communityaudience participationvloggausHuman-Computer Interactionvalenssi (psykologia)Psychology0503 educationSocial psychologyparasocial relationship
researchProduct