Search results for "Function"

showing 10 items of 14432 documents

Motor Cortex Function in Fibromyalgia: A Study by Functional Near-Infrared Spectroscopy

2019

Previous studies indicated changes of motor cortex excitability in fibromyalgia (FM) patients and the positive results of transcranial stimulation techniques. The present study aimed to explore the metabolism of motor cortex in FM patients, in resting state and during slow and fast finger tapping, using functional Near-Infrared Spectroscopy (fNIRS), an optical method which detects in real time the metabolism changes in the cortical tissue. We studied 24 FM patients and 24 healthy subjects. We found a significant slowness of motor speed in FM patients compared to controls. During resting state and slow movement conditions, the metabolism of the motor areas was similar between groups. The oxy…

lcsh:R5-920Article SubjectResting state fMRIbusiness.industrymotor cortex fibromyalgia near infra-red spectroscopy (NIRS)Stimulationmedicine.diseaseAnesthesiology and Pain Medicinemedicine.anatomical_structureFibromyalgiaFinger tappingmedicineFunctional near-infrared spectroscopyIn patientNeurology (clinical)Abnormalitylcsh:Medicine (General)businessNeuroscienceResearch ArticleMotor cortexPain Research and Treatment
researchProduct

The difference of free light chains as a predictor of kidney damage in patients with Multiple Myeloma

2022


 Background: Multiple myeloma (MM) is a malignant neoplasm characterized by the clonal expansion of plasma cells that can release monoclonal immunoglobulins (monoclonal component) or part of theme. Since 2001, the k and λ serum free light chains (sFLC) evaluation and their ratio (rFLC) have made up the laboratory analysis more sensitive and precise in MM patients. The role of rFLC has been widely studied and discussed and now it is validated in the literature. Instead, the value of free light chains difference (dFLC), especially in MM is less known yet. The aim of this study is to evaluate the relationship between the dFLC and the kidney damage parameters in patients with MM, in compa…

lcsh:R5-920medicine.medical_specialtyKidneyCreatinineeducation.field_of_studyProteinuriabusiness.industrylcsh:Public aspects of medicinePopulationUrologyRenal functionlcsh:RA1-1270medicine.diseaseImmunoglobulin light chainMultiple Myeloma free light chains difference free light chains ratio renal damagechemistry.chemical_compoundmedicine.anatomical_structurechemistrymedicineAlbuminuriamedicine.symptomlcsh:Medicine (General)businesseducationMultiple myelomaEpidemiology, Biostatistics, and Public Health
researchProduct

Staging, neurocognition and social functioning in bipolar disorder.

2018

Introduction: Bipolar disorder (BD) is associated with significant neurocognitive and functional impairment, which may progress across stages. The ‘latent stage' of BD remains understudied. This cross-sectional study assessed staging, neurocognition and social functioning among BD patients and their healthy siblings.Methods: Four groups were included: euthymic type I BD patients in the early (n = 25) and late (n = 23) stages, their healthy siblings (latent stage; n = 23) and healthy controls (n = 21). All 92 subjects underwent a comprehensive neuropsychological battery of processing speed, verbal learning/memory, visual memory, working memory, verbal fluency, executive cognition, and motor …

lcsh:RC435-571Bipolar disorderFenótiponeurocognitionVerbal learningfirst-degree relativesfunctioning03 medical and health sciencesNeurologia0302 clinical medicineVisual memorylcsh:Psychiatryclinical stagingmedicineMemóriaVerbal fluency testFirst-degree relativesFunctioningBipolar disorderNeurocognitionsiblingsOriginal ResearchPsychiatrybipolar disorderWorking memorybusiness.industrySiblingsTranstorno bipolarIrmãosCognitionmedicine.disease030227 psychiatryPsychiatry and Mental healthClinical stagingVerbal memorybusinessMalalties mentalsNeurocognitiveCogniçãoProgressão da doença030217 neurology & neurosurgeryClinical psychology
researchProduct

Well-being and functional abilities in nursing home and home living seniors in Latvia

2018

The society in developed countries is aging. 1.5% of seniors live in nursing homes in Latvia.Aim: to compare functional abilities and well-being between nursing home and home living Latvian seniors.Methods:280 home living seniors and 285 from nursing homes, age ≥ 65 years able to respond to questions and stand up were included in the study based on availability. They were asked to describe their well-being from very bad to very good. The functional abilities were assessed by hand grip strength, the ability to stand up without assistance, the dependence on caregivers (1 – independent, 2 – partly dependent, 3 – fully dependent), the use of walking device assistance devices.Results:The home li…

lcsh:Social Scienceslcsh:HGerontologyGrip strengthActivities of daily livingFunctional abilitiesWell-beingNursing homesPsychologyDeveloped countrySHS Web of Conferences
researchProduct

The Influence of Fatigue on Throwing and YBT-UQ Performance in Male Adolescent Handball Players

2020

Purpose: The goal of the present study was to assess the effects of fatigue on throwing and Upper Quarter Y Balance Test (YBT-UQ) performance in male adolescent handball players. We hypothesized that throwing and YBT-UQ performance will be decreased in response to an upper-body fatigue-protocol.Method: All male participants (N = 24, age: 14.8 ± 0.7 yrs) were handball players of a regional youth selection team. A radar gun was used for the assessment of throwing velocity. The YBT-UQ was executed assessing medial, inferolateral and superolateral reach directions normalized to the upper limb length together with a composite score. Immediately following a fatigue protocol of different sets of p…

lcsh:Sportsfunctional testingyoung athleteseducationSport- und BewegungswissenschaftenFakultät für Bildungswissenschaften » Institut für Sport- und Bewegungswissenschaftenlcsh:GV557-1198.995Sports and Active Livingexhaustionupper quarter mobility/stabilityddc:796throwing velocityhuman activitiesOriginal Research
researchProduct

A Group-Based 8-Week Functional Interval-Type Outdoor Training Program Improves Physical Performance in Recreationally Active Adults

2022

Even though physical activity is an important aspect of health, lack of time or motivation impede people from working out regularly. One type of training program that is both efficient and motivating is functional interval-type outdoor training. To evaluate this, our study had 81 participants complete a battery of physical performance tests (incremental treadmill test, core stability test and functional fitness test) before and after an 8-week outdoor interval-type training intervention. Training procedures included multimodal and high-intensity exercises performed in consistent, small groups. Results showed that the interval training program produced significant increases in the interventi…

lcsh:Sportshigh-intensity interval circuit trainingfunctional training; circuit training; multimodal exercise program; high-intensity interval circuit training; group training; core stabilitylcsh:GV557-1198.995functional trainingcore stabilitySports and Active Livingddc:790circuit traininggroup training790 Recreational and performing artsmultimodal exercise programRecreational and performing artsOriginal Research
researchProduct

Towards a sustainable leader-follower relationship: constructive dissensus, organizational virtuousness and happiness at work (haw)

2020

This paper examines how leaders and followers can interact positively under complex and bounded conditions. For this purpose, this paper conceptualizes and measures the concept of constructive dissensus. Constructive dissensus relates to a mutual understanding leading to a situation of coregulation. In addition, the relationship between constructive dissensus and happiness at work is examined on the basis of affective events theory. Furthermore, the mediating role of organizational virtuousness is assessed. Through structural equation modeling, a multilevel analysis was performed. Data from 130 bank branches and 606 employees were gathered. The results reveal a direct effect of constructive…

leadershipGeography Planning and DevelopmentTJ807-830050109 social psychologyAffective events theoryManagement Monitoring Policy and LawTD194-195:CIENCIAS ECONÓMICAS [UNESCO]ConstructiveRenewable energy sourcesStructural equation modeling0502 economics and businessFollowershipGE1-3500501 psychology and cognitive sciencesHappiness at workEnvironmental effects of industries and plantsRenewable Energy Sustainability and the Environment05 social sciencesMultilevel modelorganizational virtuousnesshappiness at workUNESCO::CIENCIAS ECONÓMICASEnvironmental sciencesBounded functionMediationPsychologySocial psychology050203 business & managementfollowership
researchProduct

System identification via optimised wavelet-based neural networks

2003

Nonlinear system identification by means of wavelet-based neural networks (WBNNs) is presented. An iterative method is proposed, based on a way of combining genetic algorithms (GAs) and least-square techniques with the aim of avoiding redundancy in the representation of the function. GAs are used for optimal selection of the structure of the WBNN and the parameters of the transfer function of its neurones. Least-square techniques are used to update the weights of the net. The basic criterion of the method is the addition of a new neurone, at a generic step, to the already constructed WBNN so that no modification to the parameters of its neurones is required. Simulation experiments and compa…

least squares approximations nonlinear dynamical systems identification neural nets iterative methods genetic algorithmsQuantitative Biology::Neurons and CognitionArtificial neural networkNonlinear system identificationIterative methodComputer scienceSystem identificationTransfer functionWaveletSettore ING-INF/04 - AutomaticaControl and Systems EngineeringControl theoryRedundancy (engineering)Electrical and Electronic EngineeringRepresentation (mathematics)InstrumentationAlgorithmIEE Proceedings - Control Theory and Applications
researchProduct

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct

Jurisdiction in cases of divorce, legal separation or marriage annulment

2021

The subject of coordination is fundamental for the functioning of jurisdictional rules of the Regulation n.2016/1103 on matrimonial property regimes and Regulation n.2016/1104 on the property consequences of registered partnerships. Both Property Regimes Regulations have the purpose of gathering litigation before the courts of one Member State and have the related procedures managed by the courts of the same Member State. Recital 34 of Regulation No. 2016/1103 specifies that matters of matrimonial property regime related to proceedings pending before the court of a member state hearing an application for divorce, legal separation or marriage annulment should be dealt with by the courts of t…

legal separation or marriage annulmentlegal separation or marriage annulment Calabresethe concentration of jurisdiction should not be allowed without the spouses? agreement?. Unfortunatelyinternational familiesthe purpose of concentrating the proceedings is not always met. The Eu system of private international law in family matters has gradually extended its terms of reference from divorce and legal separation to the financial aspects of family lifeat least for the Member States that will take part in the enhanced cooperation. Nonethelessdivorcefamilias internacionaleslegal separation or marriage annulment may only be based on specific grounds of jurisdiction. In such casesjurisdictionlegal separation or marriage annulment should be dealt with by the courts of that Member Statepractically these topics are often addressed in the same action for divorce. Issues such as assigning the matrimonial homeit seems reasonable and in the parties? interests to have divorce and the related financial aspects handled by the same court. Coordinationconcentración de procedimientosCoordinacióndivorcioprocedimientos relacionados?unless the jurisdiction to rule on the divorceacuerdos 52 63:CIENCIAS JURÍDICAS [UNESCO]Cinzia The subject of coordination is fundamental for the functioning of jurisdictional rules of the Regulation n.2016/1103 on matrimonial property regimes and Regulation n.2016/1104 on the property consequences of registered partnerships. Both Property Regimes Regulations have the purpose of gathering litigation before the courts of one Member State and have the related procedures managed by the courts of the same Member State. Recital 34 of Regulation No. 2016/1103 specifies that matters of matrimonial property regime related to proceedings pending before the court of a member state hearing an application for divorceagreements.UNESCO::CIENCIAS JURÍDICASand to the conditions and reasons that ground that ruling. The need to coordinate between the EU instruments becomes apparent because spouses litigate over the financial consequences of divorce. As a result2386-4567 22661 Actualidad jurídica iberoamericana 587897 2021 15 8113548 Jurisdiction in cases of divorcerelated procedurescompetenciaand the definition of the obligation of one spouse to support the other financially are strongly and substantially connected to the ruling on divorceconcentrating proceedingsseparación legal o anulación matrimonial
researchProduct