Search results for "IDE"

showing 10 items of 55536 documents

Controlled Cytotoxicity of Plasma Treated Water Formulated By Open-air Hybrid Mode Discharge

2017

Plasma‐activated liquids (PAL) attract increasing interest with demonstrated biological effects. Plasma exposure in air produces stable aqueous reactive species which can serve as chemical diagnostics of PAL systems. Here, we tailor aqueous reactive species inside plasma‐activated water (PAW) through treating water with AC air spark and glow discharges in contact with water. Chemical probing demonstrated species specificity between two types of PAW. Spark discharge PAW contains urn:x-wiley:14381656:media:ppap201600207:ppap201600207-math-0006 and urn:x-wiley:14381656:media:ppap201600207:ppap201600207-math-0007, while urn:x-wiley:14381656:media:ppap201600207:ppap201600207-math-0008and urn:x-w…

010302 applied physicsPlant growthChromatographyPhysics and Astronomy (miscellaneous)Treated waterChemistry02 engineering and technologyPlasmaHuman decontaminationglow discharge021001 nanoscience & nanotechnology01 natural scienceschemistry.chemical_compoundEnvironmental chemistryelectrolysis0103 physical sciencesNitritereactive species0210 nano-technologyHydrogen peroxideCytotoxicityBiologyOpen airplasma-activated waterspark discharge
researchProduct

Lead evaporation instabilities and failure mechanisms of the micro oven at the GTS-LHC ECR ion source at CERN

2020

The GTS-LHC ECR ion source (named after the Grenoble Test Source and the Large Hadron Collider) at CERN provides heavy ion beams for the chain of accelerators from Linac3 up to the LHC for high energy collision experiments and to the Super Proton Synchrotron for fixed target experiments. During the standard operation, the oven technique is used to evaporate lead into the source plasma to produce multiple charged lead ion beams. Intensity and stability are key parameters for the beam, and the operational experience is that some of the source instabilities can be linked to the oven performance. Over long operation periods of several weeks, the evaporation is not stable which makes the tuning …

010302 applied physicsRange (particle radiation)Large Hadron ColliderMaterials scienceionitNuclear engineeringEvaporationPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesSuper Proton SynchrotronIon source010305 fluids & plasmasIonComputer Science::OtherPhysics::Popular Physics0103 physical scienceslyijyInstrumentationBeam (structure)
researchProduct

A graphene-based neutral particle detector

2019

A neutral particle detector is presented, in which the traditionally used target material, indium tin oxide (ITO), is replaced by graphene. The graphene-based detector enables collinear photodetachment measurements at a significantly shorter wavelength of light down to 230 nm compared to ITO-based detectors, which are limited at 335 nm. Moreover, the background signal from the photoelectric effect is drastically reduced when using graphene. The graphene based detector, reaching 1.7 eV further into the UV energy range, allows increased possibilities for photodetachment studies of negatively charged atoms, molecules, and clusters.A neutral particle detector is presented, in which the traditio…

010302 applied physicsRange (particle radiation)Materials sciencePhysics and Astronomy (miscellaneous)business.industryGrapheneDetector02 engineering and technologyPhotoelectric effect021001 nanoscience & nanotechnology01 natural sciencesSignallaw.inventionIndium tin oxideWavelengthlaw0103 physical sciencesOptoelectronics0210 nano-technologybusinessNeutral particleApplied Physics Letters
researchProduct

Aqueous Corrosion of the GeSe4 Chalcogenide Glass: Surface Properties and Corrosion Mechanism

2009

International audience; The aqueous corrosion behavior of the GeSe4 glass composition has been studied over time under various conditions (temperature and pH). The evolution of the surface topography by atomic force microscopy and properties such as surface hardness and reduced modulus, as well as the optical transmission in the 1-16 μm window, have been measured as a function of time spent in the corrosive solution. It was found that even if the glass reacts at room temperature, its optical transparency was barely affected. Nevertheless, the durability of GeSe4 was found to be drastically affected by an increase of both temperature and pH. Furthermore, pure selenium nanoparticles were form…

010302 applied physicsReaction mechanismOptical fiberMaterials scienceMetallurgyHexagonal phaseNanoparticleChalcogenide glass02 engineering and technologyActivation energy[CHIM.MATE]Chemical Sciences/Material chemistry021001 nanoscience & nanotechnology01 natural sciencesHardnesslaw.inventionCorrosionChemical engineeringlaw[ CHIM.MATE ] Chemical Sciences/Material chemistry0103 physical sciencesMaterials ChemistryCeramics and Composites0210 nano-technology
researchProduct

Measurement of the activation energies of oxygen ion diffusion in yttria stabilized zirconia by flicker noise spectroscopy

2019

The low-frequency noise in a nanometer-sized virtual memristor consisting of a contact of a conductive atomic force microscope (CAFM) probe to an yttria stabilized zirconia (YSZ) thin film deposited on a conductive substrate is investigated. YSZ is a promising material for the memristor application since it is featured by high oxygen ion mobility, and the oxygen vacancy concentration in YSZ can be controlled by varying the molar fraction of the stabilizing yttrium oxide. Due to the low diameter of the CAFM probe contact to the YSZ film (similar to 10nm), we are able to measure the electric current flowing through an individual filament both in the low resistive state (LRS) and in the high r…

010302 applied physicsResistive touchscreenMaterials sciencePhysics and Astronomy (miscellaneous)business.industryMemristor Noise induced phenomenaOxide02 engineering and technologySubstrate (electronics)021001 nanoscience & nanotechnology01 natural sciencesNoise (electronics)chemistry.chemical_compoundchemistry0103 physical sciencesOptoelectronicsFlicker noiseThin filmElectric current0210 nano-technologybusinessYttria-stabilized zirconia
researchProduct

Low complexity digital background calibration algorithm for the correction of timing mismatch in time-interleaved ADCs

2019

Abstract A low-complexity post-processing algorithm to estimate and compensate for timing skew error in a four-channel time-interleaved analog to digital converter (TIADC) is presented in this paper, together with its hardware implementation. The Lagrange interpolator is used as the reconstruction filter which alleviates online interpolator redesign by using a simplified representation of coefficients. Simulation results show that the proposed algorithm can suppress error tones for input signal frequency from 0 to 0.4 f s . The proposed structure has, at least, 41% reduction in the number of required multipliers. Implementation of the algorithm, for a four-channel 10-bit TIADC, show that, f…

010302 applied physicsSpurious-free dynamic rangeComputer scienceDynamic range020208 electrical & electronic engineeringGeneral EngineeringSkewAnalog-to-digital converter02 engineering and technologyReconstruction filter01 natural scienceslaw.inventionReduction (complexity)law0103 physical sciences0202 electrical engineering electronic engineering information engineeringWidebandRepresentation (mathematics)AlgorithmMicroelectronics Journal
researchProduct

Optical properties and microstructure of 2.02-3.30 eV ZnCdO nanowires: effect of thermal annealing

2013

International audience; ZnCdO nanowires with up to 45% Cd are demonstrated showing room temperature photoluminescence (PL) down to 2.02 eV and a radiative efficiency similar to that of ZnO nanowires. Analysis of the microstructure in individual nanowires confirms the presence of a single wurtzite phase even at the highest Cd contents, with a homogeneous distribution of Cd both in the longitudinal and transverse directions. Thermal annealing at 550 C yields an overall improvement of the PL, which is blue-shifted as a result of the homogeneous decrease of Cd throughout the nanowire, but the single wurtzite structure is fully maintained.

010302 applied physicsTelecomunicacionesPhotoluminescenceMaterials sciencePhysics and Astronomy (miscellaneous)Annealing (metallurgy)business.industryWide-bandgap semiconductorNanowire02 engineering and technology021001 nanoscience & nanotechnologyMicrostructure01 natural sciencesHomogeneous distributionRadiative efficiency0103 physical sciences[PHYS.COND.CM-MS]Physics [physics]/Condensed Matter [cond-mat]/Materials Science [cond-mat.mtrl-sci]Optoelectronics0210 nano-technologybusinessWurtzite crystal structure
researchProduct

Controlled thermal oxidation of nanostructured vanadium thin films

2016

Abstract Pure V thin films were dc sputtered with different pressures (0.4 and 0.6 Pa) and particle incident angles α of 0°, 20° and 85°, by using the GLancing Angle Deposition (GLAD) technique. The sputtered films were characterized regarding their electrical resistivity behaviour in atmospheric pressure and in-vacuum conditions as a function of temperature (40–550 °C), in order to control the oxidation process. Aiming at comprehending the oxidation behaviour of the samples, extensive morphological and structural studies were performed on the as-deposited and annealed samples. Main results show that, in opposition to annealing in air, the columnar nanostructures are preserved in vacuum con…

010302 applied physicsThermal oxidationMaterials scienceNanostructureAtmospheric pressureAnnealing (metallurgy)Mechanical EngineeringMetallurgyVanadiumchemistry.chemical_element02 engineering and technology021001 nanoscience & nanotechnologyCondensed Matter Physics01 natural sciencesVanadium oxidechemistryMechanics of MaterialsElectrical resistivity and conductivity0103 physical sciencesGeneral Materials ScienceThin filmComposite material0210 nano-technologyMaterials Letters
researchProduct

Positron trapping defects in free-volume investigation of Ge–Ga–S–CsCl glasses

2016

Abstract Evolution of free-volume positron trapping defects caused by crystallization process in (80GeS 2 –20Ga 2 S 3 ) 100−х (СsCl) x , 0 ≤ x ≤ 15 chalcogenide-chalcohalide glasses was studied by positron annihilation lifetime technique. It is established that CsCl additives in Ge–Ga–S glassy matrix transform defect-related component spectra, indicating that the agglomeration of free-volume voids occurs in initial and crystallized (80GeS 2 –20Ga 2 S 3 ) 100−х (СsCl) x , 0 ≤ x ≤ 10 glasses. Void fragmentation in (80GeS 2 –20Ga 2 S 3 ) 85 (СsCl) 15 glass can be associated with loosing of their inner structure. Full crystallization in each of these glasses corresponds to the formation of defe…

010302 applied physicsVoid (astronomy)RadiationMaterials scienceAnalytical chemistryChalcogenide glassMineralogy02 engineering and technology021001 nanoscience & nanotechnology01 natural sciencesPositron trappingSpectral linelaw.inventionAbsorption edgeFragmentation (mass spectrometry)law0103 physical sciencesCrystallization0210 nano-technologyInstrumentationPositron annihilationRadiation Measurements
researchProduct

An Experimental Study of Waveguide Coupled Microwave Heating with Conventional Multicusp Negative Ion Source

2015

Negative ion production with conventional multicusp plasma chambers utilizing 2.45 GHz microwave heating is demonstrated. The experimental results were obtained with the multicusp plasma chambers and extraction systems of the RFdriven RADIS ion source and the filament driven arc discharge ion source LIISA. A waveguide microwave coupling system, which is almost similar to the one used with the SILHI ion source, was used. The results demonstrate that at least one third of negative ion beam obtained with inductive RF-coupling (RADIS) or arc discharge (LIISA) can be achieved with 1 kW of 2.45 GHz microwave power in CW mode without any modification of the plasma chamber. The co-extracted electro…

010302 applied physicsWaveguide (electromagnetism)Materials scienceFOS: Physical sciencesPlasmaElectron7. Clean energy01 natural sciencesIon sourcePhysics - Plasma Physics010305 fluids & plasmasIonPlasma Physics (physics.plasm-ph)Electric arcPhysics::Plasma Physics0103 physical sciencesAtomic physicsMicrowaveBeam (structure)
researchProduct