Search results for "Ink"

showing 10 items of 4279 documents

Vaccination with ENO1 DNA Prolongs Survival of Genetically Engineered Mice with Pancreatic Cancer

2013

Background & Aims Pancreatic ductal adenocarcinoma (PDA) is an aggressive tumor, and patients typically present with late-stage disease; rates of 5-year survival after pancreaticoduodenectomy are low. Antibodies against α-enolase (ENO1), a glycolytic enzyme, are detected in more than 60% of patients with PDA, and ENO1-specific T cells inhibit the growth of human pancreatic xenograft tumors in mice. We investigated whether an ENO1 DNA vaccine elicits antitumor immune responses and prolongs survival of mice that spontaneously develop autochthonous, lethal pancreatic carcinomas. Methods We injected and electroporated a plasmid encoding ENO1 (or a control plasmid) into Kras G12D /Cre (KC) mice …

medicine.medical_treatmentDNA Vaccine; Enolase; Parnceratic cancer; Transgeneic miceEnolasegenetically engineered miceceEnzyme-Linked Immunosorbent AssayTransgeneic miceDNA vaccination03 medical and health sciencesMice0302 clinical medicineImmune systemPancreatic cancerGenetic modelmedicineVaccines DNADNA VaccineAnimalsSurvival rate030304 developmental biology0303 health sciencesImmunity CellularHepatologybiologyENO.1; DNA Vaccine; genetically engineered miceceVaccinationGastroenterologyParnceratic cancerImmunotherapyNeoplasms Experimentalmedicine.diseaseImmunohistochemistryMice Mutant Strains3. Good healthPancreatic NeoplasmsSurvival RateSettore BIO/18 - GeneticaTumor progression030220 oncology & carcinogenesisPhosphopyruvate HydrataseImmunologybiology.proteinAntibodyENO.1Carcinoma Pancreatic Ductal
researchProduct

Induction of Type-Specific Neutralizing Antibodies by Capsomeres of Human Papillomavirus Type 33

2001

Abstract The immunogenicity of capsomeres of human papillomavirus type 33 was evaluated in a dose–response analysis. Capsomeres were obtained free of capsids by expression of L1 carrying the single point mutation C427S. Neutralizing antibodies were detected using an in vitro pseudoinfection assay. Capsomeres induced type-specific, neutralizing antibodies in mice even in the absence of adjuvant. The neutralization titers of immune sera raised without adjuvant were 10- to 20-fold lower than those of antisera to virus-like particles, but virtually identical using Freund's adjuvant. These data indicate that capsomeres may substitute for virus-like particles in future vaccines when used with an …

medicine.medical_treatmentDose-Response Relationship ImmunologicEnzyme-Linked Immunosorbent AssayAntibodies ViralpapillomavirusNeutralizationMiceCapsidNeutralization Testsdose responseVirologymedicineAnimalsHumansPapillomaviridaeAntiserumMice Inbred BALB CbiologyImmunogenicityCapsomereVirionneutralizationvaccinationVirologyTiterCapsidbiology.proteincapsomeresImmunizationAntibodyAdjuvantVirology
researchProduct

CpG-Loaded Multifunctional Cationic Nanohydrogel Particles as Self-Adjuvanting Glycopeptide Antitumor Vaccines

2014

Self-adjuvanting antitumor vaccines by multifunctional cationic nanohydrogels loaded with CpG. A conjugate consisting of tumor-associated MUC1-glycopeptide B-cell epitope and tetanus toxin T-cell epitope P2 is linked to cationic nanogels. Oligonucleotide CpG complexation enhances toll-like receptor (TLR) stimulated T-cell proliferation and rapid immune activation. This co-delivery promotes induction of specific MUC1-antibodies binding to human breast tumor cells without external adjuvant.

medicine.medical_treatmentMolecular Sequence DataBiomedical EngineeringPharmaceutical ScienceEnzyme-Linked Immunosorbent Assaymedicine.disease_causeCancer VaccinesHydrogel Polyethylene Glycol DimethacrylateEpitopeBiomaterialsAdjuvants ImmunologicCationsmedicineAnimalsHumansAmino Acid SequenceReceptorMice Inbred BALB COligonucleotideToxinChemistryGlycopeptidesGlycopeptideOligodeoxyribonucleotidesCpG siteImmunologyCancer researchNanoparticlesAdjuvantConjugateAdvanced Healthcare Materials
researchProduct

Taisteluiden kuvaus Eerikinkronikassa : sukupuolihistoriallinen näkökulma hyvään soturiuteen keskiajalla

2018

Kandidaatintutkielma taisteluista Eerikinkronikassa, johon sisältyy siinä esiintyvän soturiuden tutkiminen sukupuolihistorian näkökulmassa (maskuliinisuuden tutkimus).

medievalwarriormiddleageeerikhistoriaeerikinkronikkasukupuolimiddle-agemasculinitykronikkasoturierikskrönikansukupuolihistoriataistelut
researchProduct

Efectos del Binge Drinking sobre variables fisiológicas y cognitivas (memoria visual inmediata y memoria de trabajo) en adolescentes.

2016

El etanol es la droga dura legal más consumida en España. El uso y abuso de esta sustancia ocasiona múltiples consecuencias sociales y sanitarias por lo que se trata de uno de los problemas de salud pública más importantes tanto a nivel nacional como a nivel mundial. En muchos países, entre los que se encuentra España, el porcentaje de adolescentes que consumen alcohol es alarmante, con prevalencia de un nuevo patrón de consumo de alcohol al que coloquialmente se ha denominado “botellón” o Binge Drinking (BD) en inglés. Este patrón de consumo intensivo o en “atracón” de alcohol se caracteriza por la ingesta de grandes cantidades de alcohol de alta graduación en cortos espacios de tiempo (po…

memoria visualalcoholfrecuencia cardíaca:PSICOLOGÍA [UNESCO]adolescentesmemoria de trabajoUNESCO::PSICOLOGÍAbotellónbinge drinkingpresión arterial
researchProduct

Sokean signaalinkäsittelyn menetelmiä : sovelluksena EEG-aineiston analysointi

2011

menetelmätAMUSESOBIsignaalinkäsittelytilastotiederiippumattomien komponenttien analyysi
researchProduct

Subjektīvais un objektīvais izvērtējums sievietēm urīna nesaturēšanas gadījumā

2022

Maģistra darba ietvaros tiek pētīta urīna nesaturēšana kā aktuāla problēma sievietēm, tās diagnostikas iespējas un likumsakarības starp dzemdību skaitu, vecuma palielināšanos, ķermeņa masas indeksu un menopauzes iestāšanos. Darbs ir padziļināts pētījums, kas aizsācies jau autores bakalaura darba ietvaros. Sistemātiskie pārskati par šo problēmu norāda uz progozēm, ka slogs uz sabiedrību, pieaugot šai veselības problēmai, ievērojami palielināsies iedzīvotājiem novecojot. Pētījumu rezultāti liecina, ka urīna nesaturēšanas problēma ir pozitīvi saistīta ar dzīvesveidu, ķermeņa masas indeksu, vecumu un menopauzes iestāšanos. Arī dzemdību un ginekoloģiskiem faktoriem, kā arī menopauzes iestāšanās …

menopauzeķermeņa masas indekssdzemdībasinkontinencepopulācijas novecošanāsMedicīna
researchProduct

Neokantysta w laboratorium psychologicznym - Richarda Hönigswalda poszukiwanie zasad bytu psychicznego

2019

The specificity of Richard Hӧnigswald’s attitude to the issues raised in the Neo-Kantian philosophy was clearly visible in his approach to psychology. First of all, this covered the question of the objectivity of cognizance. Like other Neo-Kantian philosophers, Hӧnigswald undertook in his work both the problem of the relationship between philosophy and psychology and the problem of psychol- ogism. Unlike the representants of both Neo-Kantians schools, he took up psych- ology practically. In the years 1916–1930 he led the psychological laboratory of the Philosophical Seminar at the University of Wrocław, where he conducted a study of the process of thinking. Hӧnigswald took up psychology as …

mental beingpsychology of thinkingNeo-Kantianismobjectivitytheory of subjectivityStudia Philosophica Wratislaviensia
researchProduct

Rtęć w surowcach do produkcji cementu i pyłach powstających w tym procesie

2010

mercurypyły cementoweclinker burningwypalanie klinkierucement dustsrtęć
researchProduct

Tyttöjen karnevalistinen humala : tulkintoja tyttöjen alkoholikulttuurista

2001

merkityksetmielipiteetkarnevaalitalkoholinkäyttöalkoholitytötsukupuolikirjoittaminen
researchProduct