Search results for "Left Ventricular"

showing 10 items of 254 documents

Impact of diabetes on left ventricular geometry in hypertensive patients with chronic kidney disease

2009

chronic kidney disease.Left ventricular hypertrophyDiabete
researchProduct

Influence of chronic renal insufficiency on left ventricular diastolic function in hypertensives without left ventricular hypertrophy

2007

chronic renal insufficiencydiastolic function hypertension left ventricular hypertrophy.
researchProduct

Influence of geometric variations on LV activation times: A study on an atlas-based virtual population

2010

We present the fully automated pipeline we have developed to obtain electrophysiological simulations of the heart on a large atlas-based virtual population. This virtual population was generated from a statistical model of left ventricular geometry, represented by a surface model. Correspondence between tetrahedralized volumetric meshes was obtained using Thin Plate Spline warps. Simulations are based on the fast solving of Eikonal equations, and stimulation sites correspond to physiological activation. We report variations of total activation time introduced by geometry, as well as variations in the location of last activation. The obtained results suggest that the total activation time ha…

education.field_of_studyAtlas (topology)Eikonal equationPopulationGeometryStatistical modelVolume mesh030204 cardiovascular system & hematology030218 nuclear medicine & medical imaging03 medical and health sciences0302 clinical medicineFully automatedLeft ventricular geometryeducationThin plate splineMathematics
researchProduct

Hemorheological abnormalities in human arterial hypertension

2014

Blood rheology is impaired in hypertensive patients. The alteration involves blood and plasma viscosity, and the erythrocyte behaviour is often abnormal. The hemorheological pattern appears to be related to some pathophysiological mechanisms of hypertension and to organ damage, in particular left ventricular hypertrophy and myocardial ischemia. Abnormalities have been observed in erythrocyte membrane fluidity, explored by fluorescence spectroscopy and electron spin resonance. This may be relevant for red cell flow in microvessels and oxygen delivery to tissues. Although blood viscosity is not a direct target of antihypertensive therapy, the rheological properties of blood play a role in the…

erythrocyte deformabilitymedicine.medical_specialtySettore MED/09 - Medicina InternaRed Cellbusiness.industryerythrocyte membraneBlood viscosityessential hypertensionessential hypertension blood viscosity erythrocyte deformabilityCondensed Matter PhysicsEssential hypertensionmedicine.diseaseLeft ventricular hypertrophyPathophysiologyErythrocyte membraneInternal medicinePathophysiology of hypertensionblood viscositymedicineCardiologyErythrocyte deformabilityGeneral Materials SciencebusinessKorea-Australia Rheology Journal
researchProduct

Relationships between glomerular filtration rate and left ventricular mass in uncomplicated essential hypertension

2007

glomerular filtration rate left ventricular mass hypertension
researchProduct

Predictors of Left Ventricular Hypertrophy in Hypertensive Patients with Normal ECG

2011

Introduction: Early identification of left ventricular hypertrophy (LVH) in hypertensive patients is of great importance for correct stratification of cardiovascular (CV) risk. It is well known that ECGhas low sensibility in detecting LVH, while echocardiography, for organizational difficulties, cannot be performed routinely. Aim: To evaluate the prevalence of LVH and of anomalies of diastolic function in a group of hypertensive patients free of diabetes, CV diseases, and with normal ECG. Methods: We excluded patients with CV diseases, diabetes, chronic kidney disease (CKD), or having ECG-LVH or other ECG anomalies. Then, we enrolled 310 hypertensive patients (mean age 48 years). All enroll…

hypertensionecgLeft ventricular hypertrophy
researchProduct

Markers of myocardial fibrosis and inflammation in hypertensives with and without left ventricular hypertrophy

2006

inflammation hypertension left ventricular hypertrophy
researchProduct

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct

The elite judo female athlete's heart.

2022

Purpose: There is a paucity of data on physiological heart adaptation in elite-level judo female athletes. This study aimed to assess left ventricular morphology and function in highly trained elite female judokas.Methods: The study prospectively included 18 females aged 23.5 ± 2.25 years, nine elite level judokas, and nine healthy non-athlete volunteers. All participants underwent a medical examination, electrocardiogram, and transthoracic 2D echocardiogram. Left ventricular diastolic and systolic diameters and volumes were determined, and parameters of left heart geometry and function (systolic and diastolic) were measured, calculated, and compared between groups.Results: When groups were…

left ventricular geometryPhysiologyPhysiology (medical)combat sportsechocardiographyventricular remodelingphysiological adaptationFrontiers in physiology
researchProduct

Prevalence of left ventricular hypertrophy in children and young people with primary hypertension: Meta-analysis and meta-regression

2022

BackgroundLeft ventricular hypertrophy (LVH) is the main marker of HMOD in children and young people (CYP). We aimed to assess the prevalence of LVH and its determinants in CYP with primary hypertension (PH).MethodsA meta-analysis of prevalence was performed. A literature search of articles reporting LVH in CYP with PH was conducted in Medline, Embase, and Cochrane databases. Studies with a primary focus on CYP (up to 21 years) with PH were included. Meta-regression was used to analyze factors explaining observed heterogeneity.ResultsThe search yielded a total of 2,200 articles, 153 of those underwent full-text review, and 47 reports were included. The reports evaluated 51 study cohorts inc…

left ventricular hypertrophy ; primary hypertension ; children ; adolescents ; left ventricular mass indexJovesHypertensionHipertensióPressió sanguíniaCardiology and Cardiovascular MedicineInfantsChildren
researchProduct