Search results for "Left"

showing 10 items of 819 documents

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct

The elite judo female athlete's heart.

2022

Purpose: There is a paucity of data on physiological heart adaptation in elite-level judo female athletes. This study aimed to assess left ventricular morphology and function in highly trained elite female judokas.Methods: The study prospectively included 18 females aged 23.5 ± 2.25 years, nine elite level judokas, and nine healthy non-athlete volunteers. All participants underwent a medical examination, electrocardiogram, and transthoracic 2D echocardiogram. Left ventricular diastolic and systolic diameters and volumes were determined, and parameters of left heart geometry and function (systolic and diastolic) were measured, calculated, and compared between groups.Results: When groups were…

left ventricular geometryPhysiologyPhysiology (medical)combat sportsechocardiographyventricular remodelingphysiological adaptationFrontiers in physiology
researchProduct

Prevalence of left ventricular hypertrophy in children and young people with primary hypertension: Meta-analysis and meta-regression

2022

BackgroundLeft ventricular hypertrophy (LVH) is the main marker of HMOD in children and young people (CYP). We aimed to assess the prevalence of LVH and its determinants in CYP with primary hypertension (PH).MethodsA meta-analysis of prevalence was performed. A literature search of articles reporting LVH in CYP with PH was conducted in Medline, Embase, and Cochrane databases. Studies with a primary focus on CYP (up to 21 years) with PH were included. Meta-regression was used to analyze factors explaining observed heterogeneity.ResultsThe search yielded a total of 2,200 articles, 153 of those underwent full-text review, and 47 reports were included. The reports evaluated 51 study cohorts inc…

left ventricular hypertrophy ; primary hypertension ; children ; adolescents ; left ventricular mass indexJovesHypertensionHipertensióPressió sanguíniaCardiology and Cardiovascular MedicineInfantsChildren
researchProduct

Mathematical tools in a digital world

2012

There are many vantage points from which to gain a perspective on digital culture. The intersection of mathematics and mathematical tools with all things digital is one such vantage point. This implies an inspection of mathematical software. The broad lines that can be taken are the practice, education and application of mathematics. This thesis focuses on practice and application, disregarding education. With regards the former it is shown how the practice of mathematics itself has been affected by the increasingly pervasive computational nature of our world. From visualisation to theorem proving no area has been untouched. I programmed a subset of the fractal universe, L-Systems, into the…

matematiikkaideologymathematical softwareculturedigital mathematicsvisualisationsageavoin lähdekoodimathematical artdigitaalinen kulttuuricopylefttyövälineetopen-sourceideologiat
researchProduct

Surveillance and student dissent: the case of the Franco dictatorship.

2014

The rising of a powerful democratic student movement in Spain in the sixties represented a substantial stimulus to the repressive modernization of the Franco dictatorship. New containment strategies were adopted in the context of the counter-subversion and intelligence policies that the USA administration and their allies were also implementing. From this assumption, this paper analyzes the specific dynamics of surveillance on student protest, exploring the previous situation at university, the challenges introduced by the youth upheaval, the diverse responses of the establishment, the role of the American aid, and finally the consequences both for the dissidents and for the dictatorship it…

media_common.quotation_subjectNew LeftContext (language use)Modernization theoryDictatorshipDemocracyfilm.subjectUrban StudiesfilmLawPolitical economyStudent ProtestSociologyDissentSafety ResearchAdministration (government)media_commonSurveillance & Society
researchProduct

Analysis of in-silico body surface P-wave integral maps show important differences depending on the connections between coronary sinus and left atrium

2016

The electrical connections between the atrial coronary sinus (CS) and the left atrial (LA) myocardium have an effect on the overall atrial activation pattern and the P-wave morphology. In this study, we use our validated multi-scale 3D human atrial-torso model to elucidate which electro-anatomical configuration of connections between CS and LA more accurately reproduces a set of body surface P-wave integral maps (BSPiM) acquired in the clinic. We performed atrial biophysical simulations by pacing in distal and proximal LA sites. The corresponding in-silico BSPiM were then computed and compared with published clinical patterns obtained from patients. Important differences in BSPiM were obser…

medicine.medical_specialty0206 medical engineeringP waveLeft atrium02 engineering and technologyAnatomyAtrial activation020601 biomedical engineering030218 nuclear medicine & medical imaging03 medical and health sciencesOstium0302 clinical medicinemedicine.anatomical_structureLeft atrialInternal medicineBody surfacecardiovascular systemmedicineCardiologycardiovascular diseasesCoronary sinusMathematics
researchProduct

Electrocardiographic Indices of Left Ventricular Hypertrophy and Repolarization Phase Share the Same Genetic Influences: A Twin Study

2009

Background: Both left ventricular hypertrophy (LVH) and repolarization phase (RP) are known to be attributable to genetic influences, but less is known whether they share same genetic influences. The aim of this study was to investigate to what extent individual differences in electrocardiographic (ECG) LVH and RP are explained by genetic and environmental influences and whether these influences are shared between these two traits. Methods: Resting ECG recordings were obtained from 186 monozygotic and 203 dizygotic female twin individuals, aged 63 to 76 years. Latent factors, called LVH and RP, were formed to condense the information obtained from LVH indices (Cornell voltage and Cornell pr…

medicine.medical_specialty030204 cardiovascular system & hematologyLeft ventricular hypertrophyGenetic correlationCorrelationElectrocardiography03 medical and health sciences0302 clinical medicinePhysiology (medical)Internal medicineGenetic modelingHumansRepolarizationMedicineGenetic Predisposition to Diseasecardiovascular diseases030212 general & internal medicineAgedbusiness.industryOriginal ArticlesGeneral MedicineMiddle AgedHeritabilitymedicine.diseaseTwin studyEndocrinologyCardiologyFemaleHypertrophy Left VentricularCardiology and Cardiovascular MedicinebusinessAnnals of Noninvasive Electrocardiology
researchProduct

Cardiorenal syndrome type 4: From chronic kidney disease to cardiovascular impairment

2016

Cardiorenal syndrome type 4 (CRS type 4), or chronic renocardiac syndrome, has been defined as "chronic abnormalities in renal function leading to cardiac disease" and recognizes the extreme burden of cardiovascular disease (CVD) risk in patients with chronic kidney disease (CKD). CKD is common and increasingly recognized as a risk factor for CVD. Even though the treatment for CVD has dramatically improved over the past decades, it still takes responsibility for up to 50% of deaths in CKD patients. For this reason, patients with CKD should be thoroughly evaluated for cardiovascular risk factors that require careful management, given the significant burden of CRS type 4 on the healthcare sys…

medicine.medical_specialty030232 urology & nephrologyRenal functionCardiorenal syndromeDisease030204 cardiovascular system & hematologyurologic and male genital diseasesLeft ventricular hypertrophyAtherosclerosis; Cardiorenal syndrome type 4; Cardiovascular risk; Chronic kidney disease; Hypertension; Left ventricular hypertrophy; Atherosclerosis; Cardio-Renal Syndrome; Disease Progression; Humans; Hypertension; Hypertrophy Left Ventricular; Renal Dialysis; Renal Insufficiency Chronic; Risk Factors; Internal Medicine03 medical and health sciences0302 clinical medicineRenal DialysisRisk FactorsInternal medicineChronic kidney diseaseCardiorenal syndrome type 4medicineInternal MedicineHumansIn patientRenal InsufficiencyRenal Insufficiency ChronicRisk factorChronicIntensive care medicineCardio-Renal Syndromebusiness.industryLeft ventricular hypertrophyHypertrophymedicine.diseaseAtherosclerosisCardiovascular riskAtherosclerosis; Cardiorenal syndrome type 4; Cardiovascular riskLeft VentricularRenocardiac SyndromeAtherosclerosiHypertensionCardiologyDisease ProgressionHypertrophy Left VentricularbusinessKidney disease
researchProduct

Motor asymmetry attenuation in older adults during imagined arm movements

2014

International audience; Laterality is an important feature of motor behavior. Several studies have shown that lateralization in right-handed young adults (i.e., right versus left arm superiority) emerges also during imagined actions, that is when an action is internally simulated without any motor output. Such information, however, is lacking for elderly people and it could be valuable to further comprehend the evolution of mental states of action in normal aging. Here, we evaluated the influence of age on motor laterality during mental actions. Twenty-four young (mean age: 24.7 +/- 4.4 years) and 24 elderly (mean age: 72.4 +/- 3.6 years) participants mentally simulated and actually execute…

medicine.medical_specialtyAgingAGE-RELATED DIFFERENCESRIGHT HANDSCognitive NeuroscienceRight armNormal agingIMAGERYLeft armLateralization of brain functionDevelopmental psychologylcsh:RC321-571Physical medicine and rehabilitationMotor imageryArm musclemedicineYoung adultMotor asymmetrylcsh:Neurosciences. Biological psychiatry. NeuropsychiatryOriginal Researchmovement durationNONDOMINANT ARMMuscle activationCORTICOSPINAL EXCITABILITYAGING BRAINPERFORMANCEMENTAL SIMULATIONTEMPORAL FEATURESMotor asymmetryLateralityLIMB DYNAMICSMotor Imagery[ SCCO ] Cognitive sciencePsychologyNeuroscience
researchProduct

9.11 Association between Plasma Aldosterone, Metabolic Syndrome and Left Ventricular Mass in Essential Hypertension

2008

medicine.medical_specialtyAldosteronebusiness.industrymedicine.diseaseEssential hypertensionLeft ventricular masschemistry.chemical_compoundPharmacotherapychemistryInternal medicineInternal MedicineCardiologymedicineMetabolic syndromeCardiology and Cardiovascular MedicinebusinessHigh Blood Pressure & Cardiovascular Prevention
researchProduct