Search results for "Lung"

showing 10 items of 2389 documents

Allgemeines Register über die von mir gesammelten X Bände : Livonica

1819

Johana Kristofa Broces kolekcijas “Sammlung verschiedner Liefländischer Monumente ...” reģistrs Livonica, 1.-2. daļa. Rīga, [1819]. 150 lapas rokrakstā.

Zeichnungen. Lettland. Geschichte. 18. Jh.Zīmējumi. Latvija. Vēsture. 18. gs.SpezialsammlungKulturnachlaß. LettlandBrotze Johann Christoph (1742-1823)Kultūras mantojums. LatvijaZīmējumi. Latvija. Vēsture. 19. gs.Deutschbalten. LettlandLivland:HUMANITIES and RELIGION::History and philosophy subjects::History subjects [Research Subject Categories]LivonijaSpeciālie krājumiVācbaltieši. LatvijaBroce Johans Kristofs (1742-1823).Zeichnungen. Lettland. Geschichte. 19. Jh.
researchProduct

Nanodiamond Theranostic for Light-Controlled Intracellular Heating and Nanoscale Temperature Sensing

2021

Temperature is an essential parameter in all biological systems, but information about the actual temperature in living cells is limited. Especially, in photothermal therapy, local intracellular temperature changes induce cell death but the local temperature gradients are not known. Highly sensitive nanothermometers would be required to measure and report local temperature changes independent of the intracellular environment, including pH or ions. Fluorescent nanodiamonds (ND) enable temperature sensing at the nanoscale independent of external conditions. Herein, we prepare ND nanothermometers coated with a nanogel shell and the photothermal agent indocyanine green serves as a heat generato…

ZelleDDC 540 / Chemistry & allied sciencesTechnologyLetterintracellular temperature manipulation and sensingHot TemperatureMaterials scienceNanodiamond nanogel intracellular temperature manipulation and sensing photothermal applicationCellsnanodiamondphotothermal applicationNanoparticleBioengineeringNanotechnology02 engineering and technologyBestrahlungNanodiamondsHeatingGeneral Materials ScienceIrradiationPrecision MedicineNanodiamondNanoscopic scaleMechanical EngineeringTemperatureNanometerbereichGeneral ChemistryNanokristallPhotothermal therapy021001 nanoscience & nanotechnologyCondensed Matter PhysicsFluorescenceNanocrystalsNanoscalenanogelddc:540Nanostrukturiertes MaterialCarbon nanomaterialsIrradiation0210 nano-technologyNanochemistryddc:600IntracellularNanogel
researchProduct

Charge radius of the short-lived $^{68}$Ni and correlation with the dipole polarizability

2020

We present the first laser spectroscopic measurement of the neutron-rich nucleus $^{68}$Ni at the \mbox{$N=40$} subshell closure and extract its nuclear charge radius. Since this is the only short-lived isotope for which the dipole polarizability $\alpha_{\rm D}$ has been measured, the combination of these observables provides a benchmark for nuclear structure theory. We compare them to novel coupled-cluster calculations based on different chiral two- and three-nucleon interactions, for which a strong correlation between the charge radius and dipole polarizability is observed, similar to the stable nucleus $^{48}$Ca. Three-particle--three-hole correlations in coupled-cluster theory substant…

[PHYS.NUCL]Physics [physics]/Nuclear Theory [nucl-th]Nuclear Theorynucl-thNuclear TheoryFOS: Physical sciences[PHYS.NEXP]Physics [physics]/Nuclear Experiment [nucl-ex]nucl-exNuclear Theory (nucl-th)Nuclear Physics - Theoryddc:530Nuclear Physics - ExperimentPhysics::Atomic PhysicsNuclear Experiment (nucl-ex)Präzisionsexperimente - Abteilung BlaumNuclear ExperimentNuclear ExperimentNuclear Physics
researchProduct

Plasma diagnostic tools for ECR ion sources : What can we learn from these experiments for the next generation sources

2019

International audience; The order-of-magnitude performance leaps of ECR ion sources over the past decades result from improvements to the magnetic plasma confinement, increases in the microwave heating frequency, and techniques to stabilize the plasma at high densities. Parallel to the technical development of the ion sources themselves, significant effort has been directed into the development of their plasma diagnostic tools. We review the recent results of Electron Cyclotron Resonance Ion Source (ECRIS) plasma diagnostics highlighting a number of selected examples of plasma density, electron energy distribution, and ion confinement time measurements, obtained mostly with the second-gener…

[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Solenoidmagnetic fieldshiukkaskiihdyttimetplasmafysiikka7. Clean energy01 natural sciencesbremsstrahlungElectron cyclotron resonance010305 fluids & plasmasIonoptical emission spectroscopySuperposition principleion sourcesPhysics::Plasma Physics0103 physical sciencesInstrumentation010302 applied physicsPhysics[PHYS]Physics [physics]plasma confinementplasma properties and parametersplasma diagnosticssyklotronitplasma heatingPlasmaIon sourceComputational physicsMagnetic fieldPlasma diagnostics
researchProduct

Alcoholic beverages, obesity, physical activity and other nutritional factors, and cancer risk: A review of the evidence

2016

International audience; Purpose: Prevention is a priority in the fight against cancers, especially nutritional prevention. To update the levels of evidence of relationships between 10 nutritional factors and cancer risk, the scientific literature published from 2006 to 2014 was reviewed by an expert group.Methods: Data from 133 meta-analyses, pooled analyses or intervention trials were examined. Nearly 150 relationships between nutritional factors and cancer at various sites were evaluated.Results: According to the evidence graded as convincing or probable, these factors were divided in two groups. Factors which increase the risk of cancer are alcoholic beverages, overweight and obesity, re…

[SDV.MHEP.HEM] Life Sciences [q-bio]/Human health and pathology/HematologyGastric cardia adenocarcinomaBreastfeedingReviewOverweightDose-response metaanalysis[ SDV.CAN ] Life Sciences [q-bio]/Cancer0302 clinical medicineNeoplasmsPrimary liver-cancerBeta-carotene supplementsBody-mass Index[ SDV.MHEP.HEM ] Life Sciences [q-bio]/Human health and pathology/HematologyCruciferous vegetables intakeDeveloping lung-cancer030212 general & internal medicineCancer2. Zero hungerProcessed meat consumptionAlcoholic Beverages[SDV.MHEP.HEM]Life Sciences [q-bio]/Human health and pathology/HematologyHematologyRenal-cell cancer3. Good healthOncology030220 oncology & carcinogenesisRandomized controlled-trialsRed meatmedicine.symptomAlcoholAlcohol;Beta-carotene supplements;Breastfeeding;Cancer;Diet;Obesity;Physical activity;PreventionBreastfeeding[SDV.CAN]Life Sciences [q-bio]/CancerMotor Activity03 medical and health sciences[SDV.CAN] Life Sciences [q-bio]/CancerEnvironmental healthmedicineHumansObesityExerciseCancer preventionbusiness.industryPhysical activityPreventionCancerEvidence-based medicinemedicine.diseaseObesityBeta-carotene supplementationBiotechnologyDietGeriatrics and GerontologybusinessBody mass indexCritical Reviews in Oncology/Hematology
researchProduct

Moving from Dermatomyositis Associated with Anti-Melanoma Differentiation-Associated Gene 5 Antibody to Anti-Melanoma Differentiation-Associated Gene…

2018

International audience

[SDV.MHEP.RSOA] Life Sciences [q-bio]/Human health and pathology/Rhumatology and musculoskeletal systemMyositis[SDV.MHEP.RSOA]Life Sciences [q-bio]/Human health and pathology/Rhumatology and musculoskeletal systemMyopathyInterstitial lung diseaseComputingMilieux_MISCELLANEOUSDermatomyositisAutoantibodies
researchProduct

Un établissement rural mérovingien à Delle "La queue au loup" (territoire de Belfort)

2010

This merovingian establishment discovered during an archaeological evaluation to the west of the town of Delle in the Belfort territory is located on the Batte hillside about 300 m from the large Gallo-roman domain on the opposite slope of the valley. This settlement is characterised by a large edifice built of stone and perishable materials, which replaces a timber framed building. The building covers 230 m2 and vestiges of the floors, partitions and interior fittings are preserved which is rare for the period. The analysis of phosphate levels has given indications as to the function of each room. The finds are modest, but they do date, along with radiocarbon analysis, the settlement from …

[SHS.ARCHEO] Humanities and Social Sciences/Archaeology and PrehistoryJura mountain range[SHS.ARCHEO]Humanities and Social Sciences/Archaeology and Prehistory6th-7th centuryvie-viie siècleédifice maçonnéanalyse de phosphateJurabogenPfostenbauphosphate analysisPhosphatanalyse6.-7. Jh.Timber framed buildingmasonryBâtiment sur poteauxhabitat isolé[ SHS.ARCHEO ] Humanities and Social Sciences/Archaeology and PrehistoryArc jurassienisolated settlementgemauertes Bauwerkisolierter Siedlungskomplex
researchProduct

Das Bleigewicht aus dem Hofareal der Fürstin von Vix auf dem Hochplateau des Mont Lassois.

2021

Das Bleigewicht aus dem Hofareal der Fürstin von VixDer Mont Lassois bei Vix, Dép. Côte d’Or, zählt neben der Heuneburg zu den am besten erforschten Fürstensitzen imfrühkeltischen Westhallstattkreis. 1953 wurde das späthallstattzeitliche Fürstinnengrab von Vix entdeckt. Im Rahmendes deutsch-französischen Forschungsprojektes »Keltische Fürstensitze westlich des Rheins« (1991-1997) und desfranzösischen PCR-Projektes (Projet collectif de recherche) »Vix et son environnement« (seit 2002) mit Beteiligungder Universitäten Dijon, Kiel, Wien und Zürich wurden die Altgrabungen (1930-1974) wieder aufgenommen. Bei derUntersuchung des späthallstattzeitlichen Hofareals der Fürstin von Vix auf dem Hochpl…

[SHS.ARCHEO] Humanities and Social Sciences/Archaeology and Prehistory[SHS.ARCHEO]Humanities and Social Sciences/Archaeology and PrehistoryVix/Mont Lassois / Hallstatt period princely seats / early Celtic town / courtyard of the Lady of Vix / Hallstatt apsidal building / Hallstatt lead weight / system of weights / market or larger meeting placeVix/Mont Lassois / hallstattzeitliche Fürstensitze / frühkeltische Stadt / Hofareal der Fürstin von Vix / hallstattzeitliche Apsidengebäude / hallstattzeitliches Bleigewicht / Gewichtssystem / Markt- oder größerer VersammlungsplatzVix/Mont Lassois / sites princiers hallstattiens / ville celtique précoce / cour de la Dame de Vix / bâtiments à abside hallstattiens / poids en plomb hallstattien / système pondéral / marché ou place centrale
researchProduct

Observations préliminaires à l'étude des remplissages des tombes du Néolithique moyen I de Gurgy "Les Noisats" (Yonne)

2008

This paper presents results of experimental digging and filling of a pit in gravel context. That experimentation is the first step of an integrated analysis about sedimentary dynamic in neolithic burials from Gurgy « Les Noisats » (Yonne, France).

[SHS.ARCHEO] Humanities and Social Sciences/Archaeology and Prehistory[SHS.ARCHEO]Humanities and Social Sciences/Archaeology and PrehistoryremplissageburialGrabstättetaphonomyfillingAuffüllungtaphonomiesépulturealluvial contextterrasse alluvialesédimentationsedimentäre Flussterrasse
researchProduct

OCCUPATIONS DOMESTIQUE ET FUNÉRAIRE DE L'ÂGE DU FER À LAVAU (AUBE)

2007

Dieser Artikel stellt die Ergebnisse einer Rettungsgrabung (Inrap) vor, die in der Gemeinde Lavau im Departement Aube durchgeführt wurde. Zwei unterschiedliche Besiedlungen konnten klar identifi ziert werden : ein Teil eines Bauernhofs aus der späten Bronze-/ frühen Hallstattzeit sowie eine kleine Nekropole aus der Mittellatènezeit. Während der Bauernhof typisch für einen ländlichen Betrieb dieser Zeit ist, unterscheidet sich die Nekropole von dem, was man erwarten würde. Ihre Lage, ihre Organisation, sowie manche Bestattungsbräuche sind aussergewöhnlich.

[SHS.ARCHEO] Humanities and Social Sciences/Archaeology and Prehistory[SHS.ARCHEO]Humanities and Social Sciences/Archaeology and Prehistorysettlement and cemeteryHallstattSpätbronzezeitSiedlung und NekropoleLate Bronze agehabitat et nécropolemiddle Iron ageChampagne-ArdenneLa Tène moyenneAube14C[ SHS.ARCHEO ] Humanities and Social Sciences/Archaeology and PrehistoryC14MittellatènezeitBronze final
researchProduct