Search results for "Ntic"

showing 10 items of 6004 documents

Early clinical outcomes after small incision lenticule extraction surgery (SMILE)

2018

Abstract Purpose Dry eye is known to impact on clinical outcomes after laser vision correction and the use of a newer ‘all femtosecond laser’ surgical approach may be associated with less impact on the ocular surface post-operatively. The purpose of this study was to evaluate the early clinical outcomes and tear instability after the first small incision lenticule extraction (SMILE) cases undertaken by three surgeons at a single site in the UK. Methods Retrospective audit. Seventy-one eyes of 37 patients underwent SMILE surgery using the Zeiss VisuMax laser system (Carl Zeiss Meditec, Germany). Uncorrected and corrected distance visual acuity, spherical equivalent refraction, fluorescein en…

AdultMalemedicine.medical_specialtyVisual acuityDistance visual acuitygenetic structuresCorneal Surgery LaserCorneal StromaVisual AcuityRefraction Ocularlaw.invention03 medical and health sciences0302 clinical medicineSingle sitelawOphthalmologyMyopiamedicineHumansSmall incision lenticule extractionSmile surgeryRetrospective StudiesSurgical approachKeratometerbusiness.industryCorneal TopographyGeneral Medicineeye diseasesSurgeryOphthalmologyTears030221 ophthalmology & optometryFemaleLasers Excimersense organsmedicine.symptombusinessOcular surface030217 neurology & neurosurgeryOptometry
researchProduct

Efficacy of low level laser therapy in reducing postoperative pain after endodontic surgery-- a randomized double blind clinical study.

2004

The aim of the study was to evaluate the effect of low level laser application on postoperative pain after endodontic surgery in a double blind, randomized clinical study. Fifty-two healthy adults undergoing endodontic surgery were included into the study. Subsequently to suturing, 26 patients had the operation site treated with an 809 nm-GaAlAs-laser (oralaser voxx, Oralia GmbH, Konstanz, Germany) at a power output of 50 mW and an irradiation time of 150 s. Laser treatment was simulated in further 26 patients. Patients were instructed to evaluate their postoperative pain on 7 days after surgery by means of a visual analogue scale (VAS). The results revealed that the pain level in the laser…

AdultMalemedicine.medical_specialtyVisual analogue scalePostoperative painmedicine.medical_treatmentStatistics Nonparametriclaw.inventionClinical studyDouble blindRandomized controlled trialDouble-Blind MethodlawMedicineHumansLow-Level Light TherapyLow level laser therapyPain MeasurementPain Postoperativebusiness.industryApicoectomySurgeryClinical trialEndodontic surgeryOtorhinolaryngologyAnesthesiaRetrograde ObturationSurgeryFemaleOral SurgerybusinessInternational journal of oral and maxillofacial surgery
researchProduct

Elderly adults delay proprioceptive reweighting during the anticipation of collision avoidance when standing.

2012

The ability to reweight visual and proprioceptive information is critical for maintaining postural stability in a dynamic environment. In this study, we examined whether visual anticipation of collision avoidance (AV) while standing could facilitate the down-weighting of altered proprioception in young and elderly adults. Twelve young (24.91 ± 6.44 years) and 12 elderly (74.8 ± 6.42 years) participants stood upright for 180 s under two task conditions: (a) quiet stance (QS) and (b) standing while anticipating virtual objects to be avoided. In order to disrupt the accuracy of proprioceptive input participants were exposed to bilateral Achilles tendon vibration during the middle 60 s of stand…

AdultMalemedicine.medical_specialtyVisual perceptiongenetic structuresPostureRod and frame testSensory systemDevelopmental psychology03 medical and health sciences0302 clinical medicinePhysical medicine and rehabilitationCenter of pressure (terrestrial locomotion)medicineAvoidance LearningHumansAgedAchilles tendonProprioceptionGeneral NeuroscienceAge Factors030229 sport sciencesAnticipation PsychologicalProprioceptionVisual fieldmedicine.anatomical_structureQUIETVisual PerceptionFemaleVisual FieldsPsychology030217 neurology & neurosurgeryPhotic StimulationPsychomotor PerformanceNeuroscience
researchProduct

Residual vein thrombosis for assessing duration of anticoagulation after unprovoked deep vein thrombosis of the lower limbs: the extended DACUS study.

2011

Abstract The safest duration of anticoagulation after idiopathic deep vein thrombosis (DVT) is unknown. We conducted a prospective study to assess the optimal duration of vitamin K antagonist (VKA) therapy considering the risk of recurrence of thrombosis according to residual vein thrombosis (RVT). Patients with a first unprovoked DVT were evaluated for the presence of RVT after 3 months of VKA administration; those without RVT suspended VKA, while those with RVT continued oral anticoagulation for up to 2 years. Recurrent thrombosis and/or bleeding events were recorded during treatment (RVT group) and 1 year after VKA withdrawal (both groups). Among 409 patients evaluated for unprovoked DVT…

AdultMalemedicine.medical_specialtyVitamin Kmedicine.drug_classDeep veinHemorrhageDrug Administration ScheduleSettore MED/15 - Malattie Del SangueRecurrenceRisk Factorsdeep vein thrombosis (DVT)Residual vein thrombosismedicineHumansProspective Studiesdeep vein thrombosis (DVT); vitamin K antagonist (VKA) therapy; Residual vein thrombosisProspective cohort studyAgedUltrasonographyVenous Thrombosisbusiness.industryAcenocoumarolAnticoagulantsHematologyVenous ThromboembolismVitamin K antagonistMiddle Agedmedicine.diseaseThrombosisConfidence intervalSurgeryClinical trialVein thrombosisvitamin K antagonist (VKA) therapymedicine.anatomical_structureLower ExtremityRelative riskFemaleWarfarinbusiness
researchProduct

Is it necessary to alter anticoagulation therapy for tooth extraction in patients taking direct oral anticoagulants?

2017

Background The number of patients using direct oral anticoagulants (DOACs) instead of vitamin K antagonists (VKA) is increasing and there is limited data on the safety of tooth extractions in patients taking DOACs. The aim of this study was to compare the amount of bleeding (AOB) and postoperative complications after tooth extractions between patients taking VKAs and patients taking DOACs without altering the anticoaguation therapy. Material and Methods The study consisted of four groups: Direct thrombin inhibitor group, factor Xa inhibitor group, warfarin group and a control group. A single tooth was extracted in each patient and routine coagulation test values were recorded prior to extra…

AdultMalemedicine.medical_specialtyVitamin Kmedicine.drug_mechanism_of_actionFactor Xa InhibitorAdministration OralPostoperative Hemorrhage030204 cardiovascular system & hematologyDirect oral anticoagulants03 medical and health sciencesPostoperative Complications0302 clinical medicineRivaroxabanChi-square testmedicineHumansApixabanProspective StudiesProspective cohort studyGeneral DentistryAgedAged 80 and overbusiness.industryResearchWarfarinAnticoagulants030206 dentistryMiddle Aged:CIENCIAS MÉDICAS [UNESCO]DabigatranSurgeryRegimenOtorhinolaryngologyCoagulationDirect thrombin inhibitorUNESCO::CIENCIAS MÉDICASTooth ExtractionFemaleSurgeryAnalysis of varianceOral Surgerybusinessmedicine.drugMedicina Oral Patología Oral y Cirugia Bucal
researchProduct

Comparative neurocognitive effects of lithium and anticonvulsants in long-term stable bipolar patients

2015

Background: The aim of choosing a mood-stabilizing drug (lithium or anticonvulsants) or a combination of them with minimal neurocognitive effects is to stimulate the development of criteria for a therapeutic adequacy, particularly in Bipolar Disorder (BD) patients who are clinically stabilized. Method: Three groups of BD patients were established according to their treatment: (i) lithium monotherapy (n=29); (ii) lithium together with one or more anticonvulsants (n=28); and (iii) one or more anticonvulsants (n=16). A group of healthy controls served as the control (n=25). The following tests were applied: Wechsler Adult Intelligence Scale, Trail Making Test, Wechsler Memory Scale, Rey Comple…

AdultMalemedicine.medical_specialtyWechsler Memory ScaleBipolar DisorderTrail Making TestNeuropsychological TestsAudiologyExecutive FunctionYoung Adult03 medical and health sciences0302 clinical medicineVisual memoryWisconsin Card Sorting TestAntimanic AgentsmedicineHumansAttentionWorking memoryWechsler Adult Intelligence ScaleMiddle AgedExecutive functions030227 psychiatryPsychiatry and Mental healthClinical PsychologyMemory Short-TermLithium CompoundsAnticonvulsantsDrug Therapy CombinationFemaleCognition DisordersPsychologyNeurocognitive030217 neurology & neurosurgeryClinical psychologyJournal of Affective Disorders
researchProduct

A multicenter clinical trial on the use of alpha1-antichymotrypsin-prostate-specific antigen in prostate cancer diagnosis

2001

BACKGROUND The aim was to evaluate the clinical performance of alpha1-antichymotrypsin prostate-specific antigen (PSA-ACT) for early diagnosis of prostate cancer (PCa) in a multicenter trial. METHODS Three hundred sixty-seven white men with PCa and 290 with benign prostatic hyperplasia (BPH) with tPSA concentrations between 2 and 20 μg/L were analyzed. The Elecsys system 2010 (Roche Diagnostics, Germany) was used for determination of total PSA (tPSA) and free PSA (fPSA). The PSA-ACT test was a prototype assay used on the ES system (Roche Diagnostics). RESULTS The median concentrations of tPSA (PCa: 8.43 μg/L vs. BPH: 6.60 μg/L) and PSA-ACT (8.30 μg/L vs. 6.46 μg/L) were significantly differ…

AdultMalemedicine.medical_specialtyalpha 1-AntichymotrypsinUrologyProstatic HyperplasiaUrologyEnzyme-Linked Immunosorbent Assayurologic and male genital diseasesStatistics NonparametricProstate cancerProstateMulticenter trialmedicineHumansProtease InhibitorsAlpha1 AntichymotrypsinAgedAged 80 and overGynecologyReceiver operating characteristicbusiness.industryArea under the curveAntibodies MonoclonalProstatic NeoplasmsMiddle AgedProstate-Specific Antigenmedicine.diseaseClinical trialProstate-specific antigenmedicine.anatomical_structureROC CurveOncologybusinessThe Prostate
researchProduct

Surgical Treatment of Extravasation Injuries

2005

The authors present their experience of treating anti-cancer drug extravasation by means of a composite surgical technique that consists of infiltration with physiological solution and hyaluronidase and subsequent manual aspiration of solutes alternated with profuse irrigation of the infiltrated area. In the immediate post-op we carry out a medical therapy that consists of calciparine and topic antibiotic and/or steroid creams. Since the year 2000 this technique has been used on 25 patients. We have had neither complications nor scars. Copyright 2005 Wiley-Liss, Inc Surgical treatment of extravasation injuries. Napoli P, Corradino B, Badalamenti G, Tripoli M, Vieni S, Furfaro MF, Cordova A,…

AdultMalemedicine.medical_specialtyantiblastictreatment KeyWords Plus:ANTITUMOR AGENTSextravasation injury; antiblastic; prevention; treatmentANTITUMOR AGENTS; APPROPRIATE MANAGEMENT; TISSUE EXTRAVASATION; HYALURONIDASE [Author Keywords]Drug ExtravasationTherapeutic irrigationScarsAntineoplastic AgentsTISSUE EXTRAVASATIONAPPROPRIATE MANAGEMENTCicatrixpreventionBiopsymedicineHumansCalciparineAuthor Keywords:extravasation injurySurgical treatmentTherapeutic IrrigationAgedRetrospective Studiesmedicine.diagnostic_testbusiness.industryBiopsy NeedleGeneral MedicineHYALURONIDASEMiddle Agedmedicine.diseaseHandExtravasationSurgeryAnti-Bacterial Agentsanticancer drugsTreatment OutcomeOncologyAnesthesiaSurgeryFemalemedicine.symptombusinessInfiltration (medical)Extravasation of Diagnostic and Therapeutic Materials
researchProduct

The isolated orbital floor fracture from a transconjunctival or subciliary perspective-A standardized anthropometric evaluation

2015

Background The influence of orbital fractures and their repair on the rate of deformities of the lower eyelid is an ongoing source of discussion in the literature. Most of the present studies include isolated blowout as well as combined orbital fractures. Material and Methods We present a retrospective evaluation of a series of 100 patients after isolated blowout fracture repair using reference anthropometric data on standardized photographs. Analysis included eye fissure width and height, lid sulcus height, upper lid height, upper and lower iris coverage, position of cornea to palpebra inferior, canthal tilt, scleral show, ectropion and entropion. It was clearly distinguished between opera…

AdultMalemedicine.medical_specialtygenetic structuresOdontología03 medical and health sciences0302 clinical medicineCorneaPhotographymedicineHumansBody Weights and MeasuresOrthopedic ProceduresIris (anatomy)030223 otorhinolaryngologyOrbital FractureOrbital FracturesGeneral DentistryRetrospective StudiesOrthodonticsbusiness.industryResearchEyelidsEctropion030206 dentistryPlastic Surgery ProceduresSulcusAnthropometry:CIENCIAS MÉDICAS [UNESCO]medicine.diseaseCiencias de la saludeye diseasesSurgerybody regionsEntropionmedicine.anatomical_structureOtorhinolaryngologyUNESCO::CIENCIAS MÉDICASFemaleSurgerysense organsEyelidOral SurgerybusinessConjunctivaMedicina Oral Patología Oral y Cirugia Bucal
researchProduct

First clinical postmarketing experiences in the treatment of epilepsies with brivaracetam: a retrospective observational multicentre study.

2019

ObjectivesBrivaracetam (BRV) is the latest approved antiepileptic drug and acts as a synaptic vesicle protein 2A ligand. The aim of the present study was to evaluate the efficacy and tolerability of BRV in the clinical setting.DesignRetrospective, observational multicentre study.SettingWe retrospectively collected clinical data of patients who received BRV in 10 epilepsy centres using a questionnaire that was answered by the reporting neurologist.ParticipantsData of 615 epilepsy patients treated with BRV were included in the study.Primary and secondary outcome measuresEfficacy regarding seizure frequency and tolerability of BRV were evaluated. Descriptive statistics complemented by X2 conti…

AdultMalemedicine.medical_specialtylevetiracetamefficacyBrivaracetam03 medical and health sciencesEpilepsyYoung Adult0302 clinical medicineInternal medicinemedicineProduct Surveillance PostmarketingHumansIn patient030212 general & internal medicine1506tolerabilityAdverse effectRetrospective StudiesOriginal ResearchSeizure frequencyEpilepsybrivaracetambusiness.industryGeneral MedicineMiddle Agedmedicine.diseasePyrrolidinonesadverse eventsTreatment OutcomeTolerabilityNeurologymonotherapy1713Observational studyAnticonvulsantsFemaleLevetiracetambusiness030217 neurology & neurosurgerymedicine.drugBMJ open
researchProduct