Search results for "RCT"

showing 10 items of 1934 documents

An updated insight into the Sialotranscriptome of Triatoma infestans: developmental stage and geographic variations

2014

Background Triatoma infestans is the main vector of Chagas disease in South America. As in all hematophagous arthropods, its saliva contains a complex cocktail that assists blood feeding by preventing platelet aggregation and blood clotting and promoting vasodilation. These salivary components can be immunologically recognized by their vector's hosts and targeted with antibodies that might disrupt blood feeding. These antibodies can be used to detect vector exposure using immunoassays. Antibodies may also contribute to the fast evolution of the salivary cocktail. Methodology Salivary gland cDNA libraries from nymphal and adult T. infestans of breeding colonies originating from different loc…

lcsh:Arctic medicine. Tropical medicinelcsh:RC955-962030231 tropical medicine03 medical and health sciences0302 clinical medicineTriatoma infestansMedicine and Health SciencesParasitic DiseasesAnimalsGenomic libraryChagas DiseaseTriatomaSalivary Proteins and PeptidesSaliva030304 developmental biologyGene LibraryGenetics0303 health sciencesProtozoan InfectionsbiologycDNA librarySalivary Proteins and Peptides/genetics/metabolismlcsh:Public aspects of medicineHaplotypePublic Health Environmental and Occupational Healthlcsh:RA1-1270Saliva/chemistrySouth AmericaTranscriptome/geneticsbiology.organism_classificationTropical DiseasesMolecular biologyTriatoma/genetics/metabolism3. Good healthVector-Borne DiseasesInfectious DiseasesTriatomaVector (epidemiology)GenBankSialomeTranscriptome//purl.org/pe-repo/ocde/ford#3.03.06 [https]Research ArticleNeglected Tropical Diseases
researchProduct

Interfaz entre animales, el hombre y los ecosistemas: una nueva perspectiva

2011

lcsh:Arctic medicine. Tropical medicinelcsh:RC955-962lcsh:Rlcsh:MedicineGeneral Biochemistry Genetics and Molecular BiologyBiomédica
researchProduct

Parásitos intestinales. Helmintiasis

2011

lcsh:Arctic medicine. Tropical medicinelcsh:RC955-962lcsh:Rlcsh:MedicineGeneral Biochemistry Genetics and Molecular BiologyBiomédica: revista del Instituto Nacional de Salud
researchProduct

Acute and spontaneous coronary thrombosis in non-culprit artery during percutaneous coronary intervention in myocardial infarction with ST-segment el…

2015

lcsh:Diseases of the circulatory (Cardiovascular) systemmedicine.medical_specialtyAcute coronary syndromeTicagrelorCardiac & Cardiovascular Systemsmedicine.medical_treatmentAbciximabArticleSTEMICoronary thrombosisInternal medicinemedicineAbciximabST segmentMyocardial infarctionbusiness.industryPercutaneous coronary interventionPCImedicine.diseaselcsh:RC666-701Conventional PCICardiologyAcute coronary syndromeCardiology and Cardiovascular MedicinebusinessTicagrelorAcute and spontaneous occlusion of LADmedicine.drugIJC Heart & Vasculature
researchProduct

Plasma Viscosity and NLR in Young Subjects with Myocardial Infarction: Evaluation at the Initial Stage and at 3 and 12 Months

2018

In the “Sicilian study on juvenile myocardial infarction,” we had evaluated plasma viscosity (PV) and neutrophil/lymphocyte ratio (NLR) in patients with acute myocardial infarction (AMI) at the age of ⩽45 years. Now, we examined the relationship between these 2 parameters in 120 subjects (109 men and 11 women) aged ⩽45 years with recent AMI. The patients were classified according to the number of cardiovascular risk factors, the electrocardiographic criteria (ST-segment elevation myocardial infarction [STEMI] or non-ST-segment elevation myocardial infarction [NSTEMI]), and the extent of coronary stenosis, evaluated with coronary angiography. On fasting venous blood, we measured PV at the sh…

lcsh:Diseases of the circulatory (Cardiovascular) systemmedicine.medical_specialtySettore MED/09 - Medicina Internabusiness.industryLymphocytefungimedicine.diseaseneutrophil lymphocyte ratiomedicine.anatomical_structurelcsh:RC666-701Internal medicinecardiovascular systemCardiologyMedicineplasma viscosityIn patientcardiovascular diseasesMyocardial infarctionjuvenile myocardial infarctionStage (cooking)Cardiology and Cardiovascular MedicinebusinessPlasma viscosityOriginal ResearchClinical Medicine Insights: Cardiology
researchProduct

Including vegetation dynamics in an atmospheric chemistry-enabled general circulation model: linking LPJ-GUESS (v4.0) with the EMAC modelling system …

2020

Central to the development of Earth system models (ESMs) has been the coupling of previously separate model types, such as ocean, atmospheric, and vegetation models, to address interactive feedbacks between the system components. A modelling framework which combines a detailed representation of these components, including vegetation and other land surface processes, enables the study of land–atmosphere feedbacks under global climate change. Here we present the initial steps of coupling LPJ-GUESS, a dynamic global vegetation model, to the atmospheric chemistry-enabled atmosphere–ocean general circulation model EMAC. The LPJ-GUESS framework is based on ecophysiological processes, such as phot…

lcsh:GeologyBiomass (ecology)ArcticGlobal warminglcsh:QE1-996.5BiosphereEnvironmental scienceGeneral MedicineVegetationPotential natural vegetationDynamic global vegetation modelPermafrostAtmospheric sciencesGeoscientific Model Development
researchProduct

Bacterial Diversity in a Dynamic and Extreme Sub-Arctic Watercourse (Pasvik River, Norwegian Arctic)

2020

Microbial communities promptly respond to the environmental perturbations, especially in the Arctic and sub-Arctic systems that are highly impacted by climate change, and fluctuations in the diversity level of microbial assemblages could give insights on their expected response. 16S rRNA gene amplicon sequencing was applied to describe the bacterial community composition in water and sediment through the sub-Arctic Pasvik River. Our results showed that river water and sediment harbored distinct communities in terms of diversity and composition at genus level. The distribution of the bacterial communities was mainly affected by both salinity and temperature in sediment samples, and by oxygen…

lcsh:Hydraulic engineeringGeography Planning and DevelopmentClimate changesedimentitAquatic ScienceBiochemistryAlgal bloombakteerit03 medical and health scienceslcsh:Water supply for domestic and industrial purposeslcsh:TC1-978Glacial period030304 developmental biologyWater Science and TechnologyPhylotypearktinen aluelcsh:TD201-5000303 health sciences030306 microbiologyEcologyvesiekosysteemitbacterial diversityriver sediment and waterSedimentmikrobiekologiaSalinitymikrobistoTaxonvirtavedetNGSsub-Arctic systemEnvironmental scienceSurface runoffjoetWater
researchProduct

High-resolution orthophoto map and digital surface models of the largest Argentine Islands (the Antarctic) from unmanned aerial vehicle photogrammetry

2020

This study presents the first high-resolution orthophoto maps and digital surface models (DSMs) of the largest Argentine Islands, West Antarctica. Aerial surveys with small unmanned aerial vehicle (UAV) were performed in Austral summer, 2018, taking 10,041 aerial photographs. Accuracy requirements were ensured using ground control points (GCPs). A resolution of 3.4 and 6.8 cm/px of orthomosaics and DSMs is reached on average, and the RMS reprojection error is 0.22 m on average. We report the morphometric parameters of surveyed islands and discuss issues related to accuracy and the usage of UAVs in polar conditions. This study demonstrates that small and low cost UAVs can be successfully use…

lcsh:Maps010504 meteorology & atmospheric sciencesAerial surveywilhelm archipelagoGeography Planning and DevelopmentOrthophotoHigh resolution010502 geochemistry & geophysics01 natural sciencesorthomosaicPhotogrammetrywest antarcticalcsh:G3180-9980Earth and Planetary Sciences (miscellaneous)Ice capsunmanned aerial vehicle (uav)Digital surfaceGeologyice caps0105 earth and related environmental sciencesRemote sensingJournal of Maps
researchProduct

Biodiversity of Antarctic echinoids: a comprehensive and interactive database

2005

Eighty-one echinoid species are present south of the Antarctic Convergence, and they represent an important component of the benthic fauna. “Antarctic echinoids” is an interactive database synthesising the results of more than 100 years of Antarctic expeditions, and comprising information about all echinoid species. It includes illustrated keys for determination of the species, and information about their morphology and ecology (text, illustrations and glossary) and their distribution (maps and histograms of bathymetrical distribution); the sources of the information (bibliography, collections and expeditions) are also provided. All these data (taxonomic, morphologic, geographic, bathymetri…

lcsh:SH1-691DatabaseGlossaryFaunaEcology (disciplines)BiodiversitySH1-691antarcticAquatic ScienceBiologyOceanographycomputer.software_genrebase de datoslcsh:Aquaculture. Fisheries. Anglingequinoideosbiodiversidadantárticosea urchinsAquaculture. Fisheries. AnglingEchinoidea [Sea urchins]AntarcticcomputerdatabasebiodiversityScientia Marina
researchProduct

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct