Search results for "Segmentation"

showing 10 items of 674 documents

Segmentation of Employee Perceptions in Relation to Corporate Social Responsibility Practices

2013

Sustainability is changing the competitive landscape and reshaping the opportunities and threats that companies face. However, for companies to become green they need employees to develop, believe and engage with these initiatives. To achieve success with sustainable practices, companies can use internal marketing which is based on the satisfaction of employees as a premise to achieve the retention and attraction of top talent that will lead to corporate success. It is estimated that the internal customer satisfaction and loyalty contribute to satisfying the external customers, leading ultimately to a company's profit maximization. In this paper I explore the impact of companies' sustainabi…

internal marketing employee segmentation sustainability green marketing corporate social responsibilitycorporate social responsibilityinternal marketingemployee segmentationlcsh:Businesssustainabilitylcsh:HF5001-6182green marketingExpert Journal of Business and Management
researchProduct

Gestión empresarial y dinámica laboral en España

2015

El objetivo del presente artículo es plantear una serie de reflexiones sobre la dinámica labo- ral reciente en la economía española bajo el enfoque analítico de la segmentación laboral. Desde esta perspectiva, la situación y problemas del mercado laboral se explican por un conjunto de factores relacionados con las prácticas de gestión empresarial y no tanto por la regulación que limita la competencia en el mercado o las modalidades contractuales. Nues- tra conclusión es que es necesario superar el marco analítico restringido del enfoque econó- mico convencional e introducir otras dimensiones, que van más allá del mercado, para una mejor compresión de los problemas laborales. En este sentido…

jel:J68jel:L22Spanish economy labour market segmentation labour regulation corporate labour governance practicesComputerApplications_COMPUTERSINOTHERSYSTEMSjel:J50Economiajel:J81jel:J40jel:J63
researchProduct

The Analysis of Consumer Behavior in Relationship to a Global Brand in the Lodging Industry, Across Europe and North America Abstract: The world is c…

2011

jel:M10jel:M19consumer behavior market segmentation primary research global brand differentiation.REVIEW OF INTERNATIONAL COMPARATIVE MANAGEMENT
researchProduct

Market Segmentation in the Decision Making Process in Tourism

2014

In this paper, I examine the responses of 154 tourists in relation to their predisposition to purchase and the patterns and habits that are usually decisive in the decision making process regarding tourism services or products. For this research, I conducted a selective direct research, whose purpose was to obtain a segmentation of consumers who purchase tourism services based on specific dimensions of behavior. This research also implied studying the behavior of current and potential customers who purchase travel services depending on several variables for establishing different consumption habits. Thus, to establish a more detailed image of the tourists who participated in this direct and…

jel:M21consumer behavior tourism market segmentation tourist dimensions decision making processjel:M31tourist dimensionsmarket segmentationtourismdecision making processconsumer behaviorlcsh:Businesslcsh:HF5001-6182Expert Journal of Business and Management
researchProduct

CONSUMER BEHAVIOR IN TOURISM AND THE INFLUENCING FACTORS OF THE DECISION MAKING PROCESS

2013

Being part of the tourism industries requires substantial knowledge. Therefore, it is important to be aware of all the factors that influence a tourist to purchase a particular tourism product. These complex factors are vital into the final purchase decision of an offer with emotional value for customers. This paper presents the typologies of tourists and tourism, and in relation to these aspects, the different types of segmentation, as well as several motivators and determinants that tourism companies and tourists should acknowledge in order to provide the premises for a win-win situation.

jel:M31consumer behavior motivators market segmentation determinants tourists types of tourism purchaseRevista Economica
researchProduct

Musification of Accelerometry Data Towards Raising Awareness of Physical Activity

2022

Previous research has shown that the temporal dynamics of human activity recorded by accelerometers share a similar structure with music. This opens the possibility to use musical sonification of accelerometry data to raise awareness of daily physical activity. In this study a method was developed for quantifying the daily structure of human activity using multigranular temporal segmentation, and applying it to produce musical sonifications. Two accelerometry recordings of physical activity were selected from a dataset, such that one shows more physical activity than the other. These data were segmented in different time-scales so that segmentation boundaries at a given time-scale have a co…

joutilaisuussegmentationmusiikkisonificationliikuntadailyphysicalkiihtyvyysfyysinen aktiivisuus
researchProduct

HIGH QUALITY TEXTURE MAPPING PROCESS AIMED AT THE OPTIMIZATION OF 3D STRUCTURED LIGHT MODELS

2019

Abstract. This article presents the evaluation of a pipeline to develop a high-quality texture mapping implementation which makes it possible to carry out a semantic high-quality 3D textured model. Due to geometric errors such as camera parameters or limited image resolution or varying environmental parameters, the calculation of a surface texture from 2D images could present several color errors. And, sometimes, it needs adjustments to the RGB or lightness information on a defined part of the texture. The texture mapping procedure is composed of mesh parameterization, mesh partitioning, mesh segmentation unwraps, UV map and projection of island, UV layout optimization, mesh packing and mes…

lcsh:Applied optics. Photonics010504 meteorology & atmospheric sciencesComputer scienceMesh parameterizationComputingMethodologies_IMAGEPROCESSINGANDCOMPUTERVISION02 engineering and technologyTexture Mapping Structured Light Scanning Restoration 3D Visualization Photogrammetry 3D modeling01 natural scienceslcsh:Technology0202 electrical engineering electronic engineering information engineeringSegmentationComputer visionImage resolution0105 earth and related environmental sciencesComputingMethodologies_COMPUTERGRAPHICSUV mappingbusiness.industrylcsh:Tlcsh:TA1501-1820020207 software engineering3D modelingVisualizationPhotogrammetrylcsh:TA1-2040RGB color modelSettore ICAR/17 - DisegnoArtificial intelligencebusinesslcsh:Engineering (General). Civil engineering (General)Texture mappingStructured lightThe International Archives of the Photogrammetry, Remote Sensing and Spatial Information Sciences
researchProduct

Image Segmentation Techniques for Healthcare Systems

2019

The present special issue of the Journal of Healthcare Engineering collects articles written by researchers scattered around the world who belong to the academic and industrial environments. The papers of this special issue have been selected by a rigorous peer-reviewing process with the support of at least two reviewers per paper, along with the opinion written in the final decision by a component of the editorial staff. Different methods on biomedical image segmentation dedicated to healthcare systems have been developed regarding, for example, the fields of machine learning, deformable models, fuzzy models, and so on. Such methods have been applied on different biomedical image modalitie…

lcsh:Medical technologyArticle SubjectComputer scienceBiomedical EngineeringMEDLINEHealth InformaticsImage processingImage Interpretation Computer-AssistedImage Processing Computer-AssistedHumansComputer visionSettore ING-INF/05 - Sistemi Di Elaborazione Delle Informazionilcsh:R5-920Settore INF/01 - Informaticabusiness.industrySegmentation Healthcare Remote Support Medical Imaging Diagnosis Support SystemsImage segmentationEditoriallcsh:R855-855.5Settore ING-INF/06 - Bioingegneria Elettronica E InformaticaSurgeryArtificial intelligencebusinesslcsh:Medicine (General)Delivery of Health CareBiotechnologyHealthcare systemJournal of Healthcare Engineering
researchProduct

What makes segmentation good? A case study in boreal forest habitat mapping

2013

Segmentation goodness evaluation is a set of approaches meant for deciding which segmentation is good. In this study, we tested different supervised segmentation evaluation measures and visual interpretation in the case of boreal forest habitat mapping in Southern Finland. The data used were WorldView-2 satellite imagery, a lidar digital elevation model (DEM), and a canopy height model (CHM) in 2 m resolution. The segmentation methods tested were the fractal net evolution approach (FNEA) and IDRISI watershed segmentation. Overall, 252 different segmentation methods, layers, and parameter combinations were tested. We also used eight different habitat delineations as reference polygons agains…

luokitus (toiminta)Watershedbusiness.industryComputer scienceSegmentation-based object categorizationta1172ta1171Scale-space segmentationImage segmentationMachine learningcomputer.software_genreRandom forestsegmentointiRankingGeneral Earth and Planetary SciencesSegmentationArtificial intelligencekaukokartoitusbusinessDigital elevation modelcomputerlidarlaserkeilausluokitusInternational Journal of Remote Sensing
researchProduct

Efficient contour-based annotation by iterative deep learning for organ segmentation from volumetric medical images

2022

Abstract Purpose Training deep neural networks usually require a large number of human-annotated data. For organ segmentation from volumetric medical images, human annotation is tedious and inefficient. To save human labour and to accelerate the training process, the strategy of annotation by iterative deep learning recently becomes popular in the research community. However, due to the lack of domain knowledge or efficient human-interaction tools, the current AID methods still suffer from long training time and high annotation burden. Methods We develop a contour-based annotation by iterative deep learning (AID) algorithm which uses boundary representation instead of voxel labels to incorp…

lääketieteellinen tekniikkaorgan segmentationBiomedical Engineeringdeep learningsyväoppimineninteractive segmentationHealth InformaticsGeneral MedicineComputer Graphics and Computer-Aided Designmedical image annotationComputer Science ApplicationsalgoritmitRadiology Nuclear Medicine and imagingSurgeryComputer Vision and Pattern RecognitionInternational Journal of Computer Assisted Radiology and Surgery
researchProduct