Search results for "Ventricular dysfunction"

showing 10 items of 149 documents

VENTRICULAR DYSFUNCTION AND NUMBER OF NON COMPACTED SEGMENTS IN NON COMPACTION: NON-INDEPENDENT PREDICTORS

2009

VENTRICULAR DYSFUNCTION AND NUMBER OF NON COMPACTED SEGMENTS IN NON COMPACTION: NON-INDEPENDENT PREDICTORS BACKGROUND: Isolated ventricular noncompaction (IVNC) is characterized by multiple prominent trabeculations and deep intertrabecular recesses. Some reports prove that the chronic heart failure may occur in approximately half of the patients. In this report we investigate the correlation between the number of non compacted segments and entity of systolic dysfunction from the registry and subregistries of the SIEC. METHOD: To identify the correlation between ventricular dysfunction and number of segments involved in non compaction we evaluated a consecutive series of 238 patients affecte…

VENTRICULAR DYSFUNCTION AND NUMBER OF NON COMPACTED SEGMENTS IN NON COMPACTION: NON-INDEPENDENT PREDICTORS
researchProduct

The study of myocardial viability after myocardial infarction: Valve and limitations of magnetic resonance imaging compared with myocardial scintigra…

1997

International audience; Abstract: The aim of this study was to compare myocardial thickness measured by magnetic resonance imaging and quantified fixation of thallium. Twenty-one patients 61.2+/-11 years were investigated after myocardial infarction of the anterior wall in 8 cases, inferior in 10 cases, lateral in 2 cases and apical in one case. The mean angiographic ejection fraction was 46.5 +/- 19 %. Myocardial scintigraphy was performed after an exercise or pharmacological stress test and followed by a study of redistribution. The data was analysed by a quantitative method. Magnetic resonance imaging was performed with Vertical and horizontal long axis views in systole and diastole with…

VIABLE MYOCARDIUMF-18 FLUORODEOXYGLUCOSELEFT-VENTRICULAR DYSFUNCTION[ INFO.INFO-IM ] Computer Science [cs]/Medical ImagingCORONARY-ARTERY DISEASEPOSITRON EMISSION TOMOGRAPHYTL-201[INFO.INFO-IM]Computer Science [cs]/Medical Imaging[INFO.INFO-IM] Computer Science [cs]/Medical ImagingTHALLIUM UPTAKEREVASCULARIZATIONREINJECTIONIRREVERSIBLE DEFECTS
researchProduct

Stress Echocardiography and Strain in Aortic Regurgitation (SESAR protocol): Left ventricular contractile reserve and myocardial work in asymptomatic…

2020

Objectives: To analyze left ventricular (LV) myocardial deformation and contractile reserve (CR) in asymptomatic patients with severe aortic regurgitation (AR) at rest and during exercise, and their correlation with functional capacity. Background: The natural history of chronic AR is characterized by a prolonged silent phase before onset of symptoms and overt LV dysfunction. Assessment of LV systolic function and contractile reserve has an important role in the decision-making of AR asymptomatic patients. Methods: Standard echo, lung ultrasound, and LV 2D speckle tracking strain were performed at rest and during exercise in asymptomatic patients with severe AR and in age- and sex-comparabl…

aortic regurgitation contractile reserve myocardial work stress echocardiography two-dimensional strainMalemedicine.medical_specialtyLongitudinal strainstress echocardiographyHeart VentriclesAortic Valve InsufficiencyStrain (injury)Regurgitation (circulation)030204 cardiovascular system & hematologyAsymptomatictwo-dimensional strainVentricular Function LeftHeart Ventricle03 medical and health sciencesVentricular Dysfunction Left0302 clinical medicineInternal medicinecontractile reserveEchocardiography StremedicineStress EchocardiographyHumansRadiology Nuclear Medicine and imaging030212 general & internal medicineSubclinical infectionEjection fractionbusiness.industryStroke Volumeaortic regurgitation; contractile reserve; myocardial work; stress echocardiography; two-dimensional strainmedicine.diseaseaortic regurgitationLung ultrasoundmyocardial workCardiologymedicine.symptomCardiology and Cardiovascular MedicinebusinessHumanEchocardiography StressEchocardiography (Mount Kisco, N.Y.)REFERENCES
researchProduct

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct

Self-care of heart failure patients: practical management recommendations from the Heart Failure Association of the European Society of Cardiology

2020

Self-care is essential in the long-term management of chronic heart failure. Heart failure guidelines stress the importance of patient education on treatment adherence, lifestyle changes, symptom monitoring and adequate response to possible deterioration. Self-care is related to medical and person-centred outcomes in patients with heart failure such as better quality of life as well as lower mortality and readmission rates. Although guidelines give general direction for self-care advice, health care professionals working with patients with heart failure need more specific recommendations. The aim of the management recommendations in this paper is to provide practical advice for health profe…

medicine.medical_specialty2013 ACCF/AHA GUIDELINElifestyleTreatment adherenceCardiologyheart failure/dk/atira/pure/subjectarea/asjc/2700/2705Heart failureNursing030204 cardiovascular system & hematologyAMERICAN-COLLEGEEXERCISE CAPACITYpatient education03 medical and health sciencesAIR-TRAVEL0302 clinical medicineQuality of life (healthcare)MEDICATIONQUALITY-OF-LIFEHealth careself-caremedicineHumansIn patientIntensive care medicineVENTRICULAR DYSFUNCTIONbusiness.industrySymptom managementOmvårdnadSelf‐careDisease ManagementPatient educationmedicine.diseaseLifestyle3. Good healthSelf CareHeart failureChronic DiseaseSelf careQuality of LifeCARDIOVASCULAR-DISEASESSelf-care; Heart failure; Lifestyle; Patient educationPosition PaperSelf-carebusinessCardiology and Cardiovascular MedicineREDUCED EJECTION FRACTIONPatient educationTASK-FORCE
researchProduct

Impact of Right Ventricular Dysfunction on Outcomes After Transcatheter Edge-to-Edge Repair for Secondary Mitral Regurgitation

2021

OBJECTIVES This study sought to assess the impact of right ventricular dysfunction (RVD) as defined by impaired right ventricular-to-pulmonary artery (RV-PA) coupling, on survival after edge-to-edge transcatheter mitral valve repair (TMVR) for severe secondary mitral regurgitation (SMR). BACKGROUND Conflicting data exist regarding the benefit of TMVR in severe SMR. A possible explanation could be differences in RVD. METHODS Using data from the EuroSMR (European Registry on Outcomes in Secondary Mitral Regurgitation) registry, this study compared the characteristics and outcomes of SMR patients undergoing TMVR, according to their RV-PA coupling, assessed by tricuspid annular plane systolic e…

medicine.medical_specialtyAdverse outcomesVentricular Dysfunction Right030204 cardiovascular system & hematology030218 nuclear medicine & medical imaging03 medical and health sciences0302 clinical medicinePredictive Value of TestsInternal medicinemedicine.arterymedicineHumansRadiology Nuclear Medicine and imagingIn patientCardiac Surgical Procedures610 Medicine & healthMitral regurgitationbusiness.industryMitral Valve InsufficiencyRight ventricular dysfunctionTreatment Outcomemedicine.anatomical_structurePulmonary arteryCardiologyTranscatheter mitral valve repairCardiology and Cardiovascular MedicinebusinessArteryJACC: Cardiovascular Imaging
researchProduct

Epidemiology and pathophysiology of left ventricular abnormalities in chronic kidney disease: a review.

2010

Introduction Cardiovascular diseases are highly prevalent in patients with chronic kidney disease (CKD), and represent the major hazard for mortality in this population. Anomalies of left ventricular (LV) structure and function are very frequent too among CKD patients, and show a negative impact on cardiovascular prognosis. Methods We searched PubMed for manuscripts regarding left ventricular hypertrophy (LVH) in CKD. Definition of LVH was different according to different studies. Results In patients with end-stage renal disease, the prevalence of LVH is higher than 70%. Studies in patients with less advanced CKD have reported increasing prevalence of LVH along with declining renal function…

medicine.medical_specialtyAnemiaPopulationDiastoleRenal functionDiseaseurologic and male genital diseasesLeft ventricular hypertrophyKidneyRisk AssessmentVentricular Function LeftVentricular Dysfunction LeftRisk FactorsInternal medicinemedicinePrevalenceHumanscardiovascular diseasesIntensive care medicineeducationeducation.field_of_studyLeft ventricular dysfunctionbusiness.industryLeft ventricular hypertrophymedicine.diseaseChronic kidney disease.NephrologyHeart failureChronic DiseaseCardiologyDisease ProgressionKidney Failure ChronicHypertrophy Left VentricularKidney DiseasesbusinessKidney diseaseGlomerular Filtration RateJournal of nephrology
researchProduct

Elevated systolic pulmonary artery pressure for prediction of myocardial necrosis and right ventricular dysfunction in acute pulmonary embolism

2016

Kontext: Echokardiografie je v soucasnosti hlavni metodou pro vysetřeni dysfunkce prave komory (right ventricular dysfunction, RVD) u akutni plicni embolie (PE). Dysfunkce prave komory je sice spojena s nepřiznivou prognozou, dosud vsak nebyla přijata žadna obecně uznavana definice. Systolický tlak v plicnici (systolic pulmonary artery pressure, sPAP) větsinou neni soucasti kriterii RVD. Cilem nasi studie bylo zhodnotit možnost použiti sPAP v predikci nekrozy myokardu a RVD u akutni PE.Metody: Retrospektivně byly analyzovany udaje 182 pacientů s akutni PE. Pacienti s PE a hodnotami sPAP ≤ 30 mm Hg byli srovnavani s pacienty s PE a hodnotami sPAP > 30 mm Hg. Vztahy mezi sPAP na jedne straně …

medicine.medical_specialtyCardiac troponinmedicine.diagnostic_testbusiness.industryComputed tomographyV q scan030204 cardiovascular system & hematologymedicine.diseaseRight ventricular dysfunctionPulmonary embolism03 medical and health sciences0302 clinical medicineInternal medicinemedicine.arteryPulmonary arteryRisk stratificationmedicineCardiology030212 general & internal medicineMyocardial necrosisCardiology and Cardiovascular MedicinebusinessCor et Vasa
researchProduct

Echocardiography to estimate high filling pressure in patients with heart failure and reduced ejection fraction

2020

Aims: Echocardiographic assessment of left ventricular filling pressures is performed using a multi-parametric algorithm. Unselected sample of patients with heart failure with reduced ejection fraction (HFrEF) patients may demonstrate an indeterminate status of diastolic indices making interpretation challenging. We sought to test improvement in the diagnostic accuracy of standard and strain echocardiography of the left ventricle and left atrium (LA) to estimate a pulmonary capillary wedge pressure (PCWP) > 15 mmHg in patients with HFrEF. Methods and results: Out of 82 consecutive patients, 78 patients were included in the final analysis and right heat catheterization, and echocardiogram…

medicine.medical_specialtyDiastoleHeart failure030204 cardiovascular system & hematologyPulmonary veinVentricular Dysfunction Left03 medical and health sciences0302 clinical medicineInternal medicineFilling pressureHumansMedicineDiseases of the circulatory (Cardiovascular) systemPulmonary Wedge Pressure030212 general & internal medicinePulmonary wedge pressureRight heart catheterismEjection fractionPCWPReceiver operating characteristicbusiness.industrySettore ING-IND/34 - Bioingegneria IndustrialeStroke VolumeHFrEFmedicine.diseasemedicine.anatomical_structureVentricleEchocardiographyHeart failureRC666-701CardiologyCardiology and Cardiovascular MedicinebusinessIsovolumic relaxation timeESC Heart Failure
researchProduct

0137 : Takotsubo cardiomyopathy following acute cerebral events

2016

International audience; ObjectiveTakotsubo cardiomyopathy is characterized by a transient apical ventricular dysfunction typically induced by an acute stress. Acute cerebral events including ischemic stroke (IS) or Epileptic Event (EE) may both be associated with massive catecholamine release. We aimed to identify the characteristics and outcomes of patients who experienced Takotsubo syndrome complicating an IS or EE.MethodsBetween 2008 and 2013, 87 patients were admitted in our Intensive Care Unit for suspected Takotsubo syndrome, of whom 6 previously experienced acute cerebral symptoms with either IS or EE, within two days. Takotsubo syndrome was diagnosed on Cardiac Magnetic Resonance, e…

medicine.medical_specialtyEjection fractionbiologybusiness.industryCardiomyopathy[ SDV.MHEP.CSC ] Life Sciences [q-bio]/Human health and pathology/Cardiology and cardiovascular systemmedicine.diseaseTransient apical ventricular dysfunctionCulpritTroponinHemiparesis[ SDV.NEU ] Life Sciences [q-bio]/Neurons and Cognition [q-bio.NC]Heart failureT waveInternal medicinemedicinebiology.proteinCardiologyST segmentTakotsubo cardiomyopathymedicine.symptombusinessCardiology and Cardiovascular MedicineComputingMilieux_MISCELLANEOUSArchives of Cardiovascular Diseases Supplements
researchProduct