Search results for "computer science"

showing 10 items of 22367 documents

Fundamentals on the Molecular Mechanism of Action of Antimicrobial Peptides

2019

Abstract Antimicrobial peptides (AMPs) are produced by several organisms as their first line of defense. Constituted by amino acids, they may present different mechanisms of action. The antimicrobial activity can be used by the peptide-producing organism itself, as innate immune strategy, or in the industry, applying as natural source preservatives. Understanding the possibilities of the operation of these compounds is a prerequisite for the development of effective uses, as well as for the establishment of combinations, which can even expand their applications considering the possibilities of genetic manipulations. Thus, the objective of this article is to review the basic principles of AM…

010302 applied physicsPhysiological functionMaterials scienceInnate immune systemComputer scienceFirst lineAntimicrobial peptides02 engineering and technology021001 nanoscience & nanotechnologyAntimicrobial01 natural sciencesAction (philosophy)0103 physical sciencesNatural sourceMolecular mechanismGeneral Materials ScienceBiochemical engineering0210 nano-technologyOrganismSSRN Electronic Journal
researchProduct

Online Management of Hybrid DRAM-NVMM Memory for HPC

2019

Non-volatile main memories (NVMMs) offer a comparable performance to DRAM, while requiring lower static power consumption and enabling higher densities. NVMM therefore can provide opportunities for improving both energy efficiency and costs of main memory. Previous hybrid main memory management approaches for HPC either do not consider the unique characteristics of NVMMs, depend on high profiling costs, or need source code modifications. In this paper, we investigate HPC applications' behaviors in the presence of NVMM as part of the main memory. By performing a comprehensive study of HPC applications and based on several key observations, we propose an online hybrid memory architecture for …

010302 applied physicsProfiling (computer programming)Source codebusiness.industryComputer sciencemedia_common.quotation_subject02 engineering and technology01 natural sciences020202 computer hardware & architectureNon-volatile memoryMemory managementEmbedded system0103 physical sciencesMemory architecture0202 electrical engineering electronic engineering information engineeringKey (cryptography)businessDrammedia_common2019 IEEE 26th International Conference on High Performance Computing, Data, and Analytics (HiPC)
researchProduct

An Energy Saving Mechanism Based on Vacation Queuing Theory in Data Center Networks

2018

To satisfy the growing need for computing resources, data centers consume a huge amount of power which raises serious concerns regarding the scale of the energy consumption and wastage. One of the important reasons for such energy wastage relates to the redundancies. Redundancies are defined as the backup routing paths and unneeded active ports implemented for the sake of load balancing and fault tolerance. The energy loss may also be caused by the random nature of incoming packets forcing nodes to stay powered on all the times to await for incoming tasks. This paper proposes a re-architecturing of network devices to address energy wastage issue by consolidating the traffic arriving from di…

010302 applied physicsQueueing theorybusiness.industryComputer scienceNetwork packet020206 networking & telecommunicationsFault tolerance02 engineering and technologyEnergy consumptionData center networksLoad balancing (computing)01 natural sciencesNetworking hardwareBackupPower consumption0103 physical sciencesVacation queuing theory0202 electrical engineering electronic engineering information engineeringData centerbusinessComputer network
researchProduct

Lead evaporation instabilities and failure mechanisms of the micro oven at the GTS-LHC ECR ion source at CERN

2020

The GTS-LHC ECR ion source (named after the Grenoble Test Source and the Large Hadron Collider) at CERN provides heavy ion beams for the chain of accelerators from Linac3 up to the LHC for high energy collision experiments and to the Super Proton Synchrotron for fixed target experiments. During the standard operation, the oven technique is used to evaporate lead into the source plasma to produce multiple charged lead ion beams. Intensity and stability are key parameters for the beam, and the operational experience is that some of the source instabilities can be linked to the oven performance. Over long operation periods of several weeks, the evaporation is not stable which makes the tuning …

010302 applied physicsRange (particle radiation)Large Hadron ColliderMaterials scienceionitNuclear engineeringEvaporationPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesSuper Proton SynchrotronIon source010305 fluids & plasmasIonComputer Science::OtherPhysics::Popular Physics0103 physical scienceslyijyInstrumentationBeam (structure)
researchProduct

Experimental comparison of two control algorithms for low-saliency ratio interior permanent magnet synchronous motors

2018

In this paper, an experimental investigation on the comparison between the Maximum Torque Per Ampere (MTPA) and the Field Orientation Control (FOC) algorithms for interior permanent magnet synchronous machines (IPMSMs) is described, analyzed and discussed. This investigation was carried out on a small-power IPMSM with low saliency ratio. More in detail, after a previous simulation study, the control techniques have been experimentally implemented and validated through means of a dSPACE® rapid prototyping system. The performances of the two algorithms have been evaluated and compared, obtaining interesting results.

010302 applied physicsRapid prototypingControl algorithmElectromagneticsPermanent magnet synchronous motorComputer scienceRenewable Energy Sustainability and the Environment020208 electrical & electronic engineeringlow saliency ratio motor02 engineering and technologySettore ING-IND/32 - Convertitori Macchine E Azionamenti Elettrici01 natural sciencesField oriented control algorithmmaximum torque per ampere control algorithmControl theoryMagnet0103 physical sciencesAutomotive Engineering0202 electrical engineering electronic engineering information engineeringTorqueInterior permanent magnet synchronous machineAmpereMaximum torque
researchProduct

Enhanced loss model algorithm for interior permanent magnet synchronous machines

2017

This paper presents an experimental study on the impact of the parameter variations over the performances of a LMA (Loss Model Algorithm) designed for an IPMSM (Interior Permanent Magnet Synchronous Machine). In a previous work, the characterization was carried out by assessing, for several working conditions, the motor parameters that influence the motor efficiency. The proposed enhanced loss model algorithm is implemented in a rapid prototyping system and its performances, in term of efficiency, are compared with other control systems, obtaining promising results.

010302 applied physicsRapid prototypingInterior permanent magnet synchronous motorComputer science020208 electrical & electronic engineeringWork (physics)02 engineering and technologySettore ING-IND/32 - Convertitori Macchine E Azionamenti Elettrici01 natural sciencesDC motorTerm (time)Settore ING-IND/31 - Elettrotecnicaspeed control drive systemsMagnetControl system0103 physical sciences0202 electrical engineering electronic engineering information engineeringTorquepower loss minimizationSettore ING-INF/07 - Misure Elettriche E ElettronicheAlgorithmPermanent magnet synchronous machine2017 AEIT International Annual Conference
researchProduct

Parameter sensitivity of flux-linkage based sensorless control for permanent magnet synchronous motors

2017

Sensorless control can be utilized to reduce cost, size and total complexity of a motor drive or enhance reliability of the system. This paper first presents a sensorless control algorithm for a surface permanent-magnet synchronous motor (SPMSM) based on estimated flux linkages and stator currents. Within the algorithm, rotor position error can be predicted by comparing the estimated currents with measured stator currents. Performance of the sensorless control based on flux-linkages and the dependency of the algorithm on motor parameters is then numerically investigated via simulations. It is found from the investigation that the accuracy of the method depends on the motor working condition…

010302 applied physicsRotor (electric)Computer scienceStator020208 electrical & electronic engineering02 engineering and technology01 natural sciencesFlux linkagelaw.inventionMotor driveDirect torque controlControl theorylaw0103 physical sciences0202 electrical engineering electronic engineering information engineeringTorqueSensitivity (control systems)Synchronous motor2017 20th International Conference on Electrical Machines and Systems (ICEMS)
researchProduct

A Novel Fault-Tolerant Routing Algorithm for Mesh-of-Tree Based Network-on-Chips

2019

Use of bus architecture based communication with increasing processing elements in System-on-Chip (SoC) leads to severe degradation of performance and speed of the system. This bottleneck is overcome with the introduction of Network-on-Chips (NoCs). NoCs assist in communication between cores on a single chip using router based packet switching technique. Due to miniaturization, NoCs like every Integrated circuit is prone to different kinds of faults which can be transient, intermittent or permanent. A fault in any one component of such a crucial network can degrade performance leaving other components non-usable. This paper presents a novel Fault-Tolerant routing Algorithm for Mesh-of-Tree …

010302 applied physicsRouterNetwork packetbusiness.industryComputer scienceFault toleranceTopology (electrical circuits)Hardware_PERFORMANCEANDRELIABILITY02 engineering and technologyFault (power engineering)01 natural sciencesBottleneckPacket switching020204 information systems0103 physical sciencesHardware_INTEGRATEDCIRCUITS0202 electrical engineering electronic engineering information engineeringRouting (electronic design automation)businessComputer network
researchProduct

Data-driven Fault Diagnosis of Induction Motors Using a Stacked Autoencoder Network

2019

Current signatures from an induction motor are normally used to detect anomalies in the condition of the motor based on signal processing techniques. However, false alarms might occur if using signal processing analysis alone since missing frequencies associated with faults in spectral analyses does not guarantee that a motor is fully healthy. To enhance fault diagnosis performance, this paper proposes a machinelearning based method using in-built motor currents to detect common faults in induction motors, namely inter-turn stator winding-, bearing- and broken rotor bar faults. This approach utilizes single-phase current data, being pre-processed using Welch’s method for spectral density es…

010302 applied physicsSignal processingbusiness.industryRotor (electric)Computer science020208 electrical & electronic engineeringSpectral density estimationPattern recognition02 engineering and technologyFault (power engineering)01 natural sciencesAutoencoderlaw.inventionSupport vector machineStatistical classificationlaw0103 physical sciences0202 electrical engineering electronic engineering information engineeringArtificial intelligencebusinessInduction motor2019 22nd International Conference on Electrical Machines and Systems (ICEMS)
researchProduct

Low complexity digital background calibration algorithm for the correction of timing mismatch in time-interleaved ADCs

2019

Abstract A low-complexity post-processing algorithm to estimate and compensate for timing skew error in a four-channel time-interleaved analog to digital converter (TIADC) is presented in this paper, together with its hardware implementation. The Lagrange interpolator is used as the reconstruction filter which alleviates online interpolator redesign by using a simplified representation of coefficients. Simulation results show that the proposed algorithm can suppress error tones for input signal frequency from 0 to 0.4 f s . The proposed structure has, at least, 41% reduction in the number of required multipliers. Implementation of the algorithm, for a four-channel 10-bit TIADC, show that, f…

010302 applied physicsSpurious-free dynamic rangeComputer scienceDynamic range020208 electrical & electronic engineeringGeneral EngineeringSkewAnalog-to-digital converter02 engineering and technologyReconstruction filter01 natural scienceslaw.inventionReduction (complexity)law0103 physical sciences0202 electrical engineering electronic engineering information engineeringWidebandRepresentation (mathematics)AlgorithmMicroelectronics Journal
researchProduct