Search results for "effectivene"

showing 10 items of 373 documents

Interpersonal dynamics in 2-vs-1 contexts of football: the effects of field location and player roles

2019

This study analyzed the spatial-temporal interactions that sustained 2-vs-1 contexts in football at different field locations near the goal. Fifteen male players (under 15 years, age 13.2 ± 1.03 years, years of practice 4.2 ± 1.10 years), 5 defenders, 7 midfielders, and 3 attackers, participated in the study. Each participant performed a game to simulate a 2-vs-1 sub-phase as a ball carrier, second attacker, and defender at three different field locations, resulting in a total number of 142 trials. The movements of participants in each trial were recorded and digitized with TACTO software. Values of interpersonal distance between the ball carrier and defender and interpersonal angles betwee…

lcsh:BF1-990FootballEffectivenesspelianalyysiPlayers’ rolesPatterns of playlcsh:Psychologyjalkapalloplayers' rolesPsychologyAffordancesroolitGeneral PsychologyOriginal Research
researchProduct

Antecedents of daily team job crafting

2017

This study investigated potential antecedents of team job crafting defined as the extent to which team members engage together in increasing (social and structural) job resources and challenges, and decreasing hindering job demands. Mindful of the teamwork literature, we hypothesized that individual employee factors (self-efficacy for teamwork, daily affect), team features (team cohesion, climate) and the organizational context of teams (engaging leadership and organizational resources for teamwork) relate positively to daily team job crafting behaviour. Data were collected among 46 multi-professional rehabilitation teams whose members completed two daily surveys after their weekly meetings…

leadershipOrganizational Behavior and Human Resource Managementmedia_common.quotation_subjectApplied psychologyPsychological interventionTeam effectiveness050109 social psychologyPsychological safetyAffect (psychology)teamsJob craftingproactive behaviour0502 economics and businessTaverne0501 psychology and cognitive sciencesJob craftingta515Applied Psychologymedia_commonTeam compositionTeamworkComputingMilieux_THECOMPUTINGPROFESSION05 social sciencesCohesion (linguistics)antecedentsPsychologySocial psychology050203 business & management
researchProduct

Investigating the direct and indirect effects of a school-based leadership program for primary school students: Rationale and study protocol for the …

2023

Background Leadership is a valuable skill that can be taught in school, and which may have benefits within and beyond the classroom. Learning to Lead (L2L) is a student-led, primary school-based leadership program whereby older ‘peer leaders’ deliver a fundamental movement skills (FMS) program to younger ‘peers’ within their own school. Aim The aims of the study are to determine the efficacy of a peer-led FMS intervention on: (i) peer leaders’ (aged 10 to 12 years) leadership effectiveness (primary outcome), leadership self-efficacy, well-being, and time on-task in the classroom; (ii) peers’ (aged 8 to 10 years) physical activity levels, actual and perceived FMS competency, cardiorespirato…

leadershipvertaistukiMultidisciplinaryschool-based leadership programtuloksellisuusvertaisjohtamineneffectivenesskoululaisetlapset (ikäryhmät)peer leadersprimary school studentsfyysinen kuntofundamental movement skillsfyysinen aktiivisuusjohtajuusinterventiovertaissuhteetPLOS ONE
researchProduct

Spēlēs balstītas mācību platformas skolēnu angļu valodas vārdu krājuma bagātināšanai attālinātās mācībās 5. klasē

2020

Mūsdienās tehnoloģiju attīstības un distonciētās apmācības dēļ, strauji pieauga tiešsaišu komunikāciju un mācību platformu izmantošana cilvēku ikdienā. It īpaši, šī situācija skāra izglītības iestādes: skolas skolotājus, skolēnus un vecākus. Diplomdarba autors ir izpētījis vairākas spēļu balstītas mācību platformas, lai bagātinātu angļu valodas vārdu krājumu attālinātās mācībās 5. klasē. Autors ir analizējis literatūru par vārdu krājuma mācīšanos un platformu izmantošanu. Kā pētījuma metode tika izvēlēta gadījuma izpēte. Savukārt, kā datu iegūšanas metodes tika izmantotas angļu valodas skolotāju anketas, skolēnu (vecumā no 11 līdz 12 gadiem) pirms un pēc pētījuma anketas. Skolēniem bija ies…

learning platformsPedagoģijadistance learningteaching and learning vocabularyeffectiveness
researchProduct

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct

"Legislative Inflation" - An analysis of the Phenomenon in Contemporary Legal Discourse

2011

legal nihilismSociology and Political ScienceLegal pluralismeffectiveness of lawlegislative inflationKeuropean legal developmentLegal researchLegal realismLawPolitical scienceLegal opinionPhilosophy of lawEmpirical legal studiessymbolic lawsLegal nihilismLegal professionLawBaltic Journal of Law & Politics
researchProduct

Kontrollikuutio : riskipainotettu kustannusvaikuttavuuden analyysi- ja johtamismalli kunnallisessa perusterveydenhuollossa

2020

There have been calls for cost-effective public services and the integration of management control and risk management systems. Municipalities currently need to consider aging populations and diminishing financial resources. But municipal services may also include other risks, such as reputational and political risks, along with changes in legislation as well as unexpected changes in operating circumstances. Risks and how they are managed affect both the costs and the effectiveness of municipal services. However, cost-effectiveness and risks are not clear-cut concepts, especially in the public health services. Therefore, in order to better understand risks in public sector management contro…

management control systemArtikkelitterveydenhoitocost-effectivenessjulkinen sektoririsk
researchProduct

Local support for conservation is associated with perceptions of good governance, social impacts, and ecological effectiveness

2019

Local support is important for the longevity of conservation initiatives. The literature suggests that perceptions of ecological effectiveness, social impacts, and good governance will influence levels of local support for conservation. This paper examines these relationships using data from a survey of small-scale fishermen in 11 marine protected areas from six countries in the Mediterranean Sea. The survey queried small-scale fishermen regarding perceptions and support for conservation. We constructed composite scores for three categories of perceptions-ecological effectiveness, social impacts, and good governance-and tested the relationship with levels of support using ordinal regression…

management effectivenesocial impactssmall-scale fisheriemarine protected areagood governanceconservationperception
researchProduct

A brief Acceptance and Commitment Therapy intervention for depression : A randomized controlled trial with 3-year follow-up for the intervention group

2018

Abstract Objective This study examined the outcomes of a brief Acceptance and Commitment Therapy (ACT) intervention for depression delivered by novice therapists. Method Participants (N = 115) were randomized either to the brief (six sessions) ACT or to a waitlist control condition (WLC). Outcomes were assessed with diagnoses of depressive episodes (ICD-10) and questionnaires. Results After the 6-week intervention, diagnostic remission rates were 60% in the ACT and 22% in the control group. Further, 70% of the ACT participants were classified as either recovered or improved. The post-measurement between-group effect size for depression symptoms was large and favored the ACT group (BDI-II, d…

masennus050103 clinical psychologyOrganizational Behavior and Human Resource Managementmedicine.medical_specialtyHealth (social science)hyväksymis- ja omistautumisterapiaeffectivenessIntervention groupAcceptance and commitment therapylaw.invention03 medical and health sciencesBehavioral Neuroscience0302 clinical medicineRandomized controlled trialbrief interventionslawIntervention (counseling)medicine0501 psychology and cognitive sciencesAcceptance and Commitment TherapyApplied PsychologyEcology Evolution Behavior and SystematicsDepression (differential diagnoses)ta51505 social sciencesnovice therapists030227 psychiatry3. Good healthlyhytterapiadepressionPhysical therapyPsychologyJournal of Contextual Behavioral Science
researchProduct

Masennuksen pariterapian vaikuttavuuden erot tutkimusyksiköiden välillä ja niitä välittävät tekijät

2013

Tutkimuksen tarkoituksena oli selvittää masennuksen pariterapian vaikuttavuuden eroja tutkimusyksiköiden välillä ja niitä välittäviä tekijöitä. Näitä tavoitteita varten tutkittiin myös, onko pariterapia vaikuttavaa masennuksen hoidossa. Tutkimusyksiköiden välisiä eroja pariterapian tuloksellisuudessa on tutkittu vain vähän. Lisäksi tekijöitä, jotka välittävät tutkimusyksiköiden välisiä eroja masennuksen pariterapian tuloksellisuudessa ei ole ilmeisesti tutkittu. Kuitenkin masennuksen pariterapian tuloksellisuutta on tutkittu ja sen on todettu olevan tuloksellista (Kung, 2000). Tässä tutkimuksessa tarkasteltiin Länsi-Pohjan ja Pohjois-Savon tutkimusyksiköiden välisiä eroja masennuksen hoidon…

masennusvälittävät tekijät; couple therapydepressioneffectivenesspariterapiamediating factorsvaikuttavuusdifferences between research unitstutkimusyksiköiden väliset erot
researchProduct