Search results for "elisa"

showing 10 items of 169 documents

Ruumiillinen tieto sairaalaympäristöissä : valokuvia suomalaisista mielisairaalahistoriikeista

2018

mielisairaalathistoriikitpsykiatriset sairaalattunteetruumiillinen tietovalokuvat
researchProduct

Development of a sensitive and specific enzyme-linked immunosorbent assay for the determination of fludioxonil residues in fruit juices

2014

Fludioxonil is a fungicide with a singular mode of action that is widely employed in the treatment of fruit crops. A competitive enzyme-linked immunosorbent assay (cELISA) has been developed and validated for the determination of residues of this fungicide in fruit juices. A collection of monoclonal antibodies (mAbs) against the fungicide fludioxonil has been produced and characterized using direct and indirect cELISAs. The high affinity achieved (IC50lower than 0.5 μg L-1) considerably improved that obtained with previous polyclonal antibodies. The proposed cELISA was applied to the analysis of fludioxonil residues in apple juice and red grape must samples with a limit of quantification of…

Detection limitcELISAChromatographybiologymedicine.drug_classChemistryFungicideGeneral Chemical EngineeringGeneral EngineeringFludioxonilMonoclonal antibodyAnalytical ChemistryFungicidePolyclonal antibodiesbiology.proteinmedicineFruit juicesFudioxonilMode of actionSpecific enzymeAnal. Methods
researchProduct

Presidentti 2000 : mistä vaalit on tehty?

2000

poliitikotehdokkaatnaisetpresidentinvaalitvaikutuksetpoliittinen viestintätoimivaltaHalonen Tarjasanaton viestintäsukupuolilehdistökirjoittelupolitiikkamielikuvatRehn Elisabethtelevisio-ohjelmatidentiteettiAho EskoviestintäesiintymistaitomielipidetutkimusKuisma RistoHautala Heidiretoriikkajoukkoviestimet2000naisen asemaUosukainen RiittamainontavaalikampanjatpresidentitäänestäminenHakalehto Ilkka
researchProduct

Suomalaisen laitospsykiatrian historiaa

2022

lainsäädäntöterveydenhuoltolaitoshoitosairaanhoitopiiritmielisairaalatpiirihallintopsykiatriset sairaalat2000-lukupsykiatrinen hoitoavohoitososiaalihistoriaSuomipsykiatrinen kuntoutusmielisairaanhoitosairaalarakennuksethallintohistoria1800-luku1900-luku
researchProduct

Mielisairaalamuistot nykykulttuurissa

2022

monitieteisyyskokemuskerrontamuistitietopsykiatriset potilaatkulttuurihistoriamielenterveysongelmatmielisairaalatpsykiatriset sairaalatmielenterveyspsykiatrinen hoitokokemuksetmielisairaanhoitomuistelukulttuurintutkimus
researchProduct

”Sain kirjoittaa runoja eräässä huoneessa ja se vapautti mieleni” : hulluuden ja luovuuden kosketuspintoja suomalaisten mielisairaalamuistoissa

2019

muistotmielisairaalatkokemuskerrontapsykoositmielenterveyshäiriötluovuushulluusluova kirjoittaminen
researchProduct

Análisis molecular de la valoración del intervalo de tiempo óptimo entre la administración de acetato de triptorelina y la punción folicular en los t…

2023

Los fármacos análogos de la GnRH y la hCG han demostrado ser igualmente eficaces en la activación de la cascada de intermediarios de la maduración final ovocitaria que ocurre tras el estímulo ovulatorio. Sin embargo, su mecanismo de acción y por tanto los perfiles hormonales hallados tras el estímulo de los dos fármacos son muy diferentes. El tiempo más adecuado para programar la recolección ovocitaria tras la administración de acetato de triptorelina podría no ser 36 horas como ampliamente se ha pautado en los tratamientos de FIV con hCG. Este intervalo de tiempo es sumamente importante para obtener la mayor proporción posible de ovocitos MII porque procesos como el inicio de la luteinizac…

lhfármacos análogos agonistas de la hormona liberadora de gonadotrofinaUNESCO::CIENCIAS DE LA VIDA::Biología humana ::Embriología humanafecundación in vitroampiregulinabetacelulinaphlda1UNESCO::QUÍMICA::Bioquímica ::Biología molecularprogesteronapcrtrigger 36hfisiología de la reproducción humana asistidaugp2marcadores moleculares no invasivos de madurez ovocitariahumanorgs2trigger 40htrigger 30hacetato de triptorelinaUNESCO::CIENCIAS MÉDICAS ::Farmacodinámica::Acción de los medicamentosepiregulinagnrhhormonasovocito metafase iiUNESCO::CIENCIAS DE LA VIDA::Fisiología humana ::Fisiología de la reproduccióncélulas de la granulosaelisalíquido folicularefnb2embriologíacyp19a1adamts9
researchProduct

Proposal of a Citrus translational genomic approach for early and infield detection of Flavescence dorée in Vitis

2014

Flavescence dore´e (FD) is one of the most widely known grapevine yellows disease and one of the most unabated worldwide in the viticulture sector. In this paper, we outline a strategy for developing an integrated system of technologies to enable rapid, early disease FD detection and diagnosis. We propose the deployment of a newly developed sensor device, the differential mobility spectrometer (DMS), which has shown positive results with a similar vector-borne disease in Citrus. We have previously demonstrated that the gas chromatograph DMS (GC/DMS) can distinguish various citrus diseases, and the system may also allow detection of volatile organic compound (VOC) signals from a tree of othe…

0106 biological sciences0301 basic medicinePlant ScienceComputational biologyBiology01 natural sciences03 medical and health sciencesSettore AGR/07 - Genetica AgrariaBotanyProfile analysisPlant systemEcology Evolution Behavior and SystematicsDifferential mobility spectrometer early detection Flavescence dore´e phytoplasma qRT-PCR ELISA VitisfungiEarly diseasefood and beveragesSettore AGR/12 - Patologia VegetaleGrapevine yellowsSettore AGR/02 - Agronomia E Coltivazioni ErbaceeSettore AGR/03 - Arboricoltura Generale E Coltivazioni Arboree030104 developmental biologySettore AGR/14 - PedologiaFlavescence doréeGas chromatographyGas chromatography–mass spectrometryDisease transmission010606 plant biology & botany
researchProduct

Analysis of Chlorpyrifos in Water, Fruit Juice, and Honeybee Extract by Chemiluminescent Elisa

2008

Abstract The suitability of competitive enzyme-linked immunosorbent assays (ELISAs) with chemiluminescent detection-based immobilized antigen (indirect assay) for rapid and accurate determination of chlorpyrifos in various food matrices was tested. The limit of detection (LOD) values were 1–1.75 ng mL−1, the standard curve midpoint (IC50) was 3.5 ng mL−1, and the assay duration was 1.5 h. Assay application to the analysis of honeybee extract resulted in chlorpyrifos recoveries varying between 62 and 83% in 5–15 ng mL−1 herbicide concentration range.

Detection limitChromatographyChemistryBiochemistry (medical)Clinical BiochemistryFOOD/FRUIT JUICESBiochemistryCHEMILUMINESCENCECHLORPYRIFOSAnalytical Chemistrylaw.inventionStandard curveHONEYBEEchemistry.chemical_compoundlawChlorpyrifosElectrochemistryELISAFruit juiceIC50SpectroscopyChemiluminescenceAnalytical Letters
researchProduct

Assessing environmental noise exposure: does the size of the neighbourhood matter?

2013

International audience; In environmental epidemiology, studies rely on the quantification of subject'sexposures in a surface defined as the subject exposure area. For outdoor exposure, this area is often considered as the subject's neighbourhood. But, depending on the authors, the size and the nature of this neighbourhood differs, making difficult to compare results. In order to study the impact of the sampling surface on the noise exposure values affected to a subject, a high definition environmental noise model has been builton a middle-sized French city. Outdoor neighbourhood noise indices were computed at 10,394 residential buildings, using eight different sizes of buffers defined by di…

[SDV.EE]Life Sciences [q-bio]/Ecology environmentNeighborhoodsampling techniqueEnvironmental exposureEnvironmental exposure[ SDV.EE ] Life Sciences [q-bio]/Ecology environmentNoise[SDV.EE] Life Sciences [q-bio]/Ecology environmentGeography13. Climate actionEnvironmental health11. SustainabilityGeneral Earth and Planetary SciencesEnvironmental noiseNoiseNeighbourhood (mathematics)CartographyExposure modelisationGeneral Environmental ScienceEnvironmental epidemiology
researchProduct