Search results for "ionit"

showing 10 items of 142 documents

Spectroscopic study of ion temperature in minimum-B ECRIS plasma

2019

Experimentally determined ion temperatures of different charge states and elements in minimum-B confined electron cyclotron resonance ion source (ECRIS) plasma are reported. It is demonstrated with optical emission spectroscopy, complemented by the energy spread measurements of the extracted ion beams, that the ion temperature in the JYFL 14 GHz ECRIS is 5–28 eV depending on the plasma species and charge state. The reported ion temperatures are an order of magnitude higher than previously deduced from indirect diagnostics and used in simulations, but agree with those reported for a quadrupole mirror fusion experiment. The diagnostics setup and data interpretation are discussed in detail to …

010302 applied physicsMaterials scienceionitPlasma spectroscopyspektroskopiaAnalytical chemistryIon temperaturePlasmaCondensed Matter Physics7. Clean energy01 natural sciences010305 fluids & plasmasPhysics::Plasma Physicsion temperature0103 physical scienceslämpötilaspectroscopic studyOptical emission spectroscopyDoppler broadeningPlasma Sources Science and Technology
researchProduct

Lead evaporation instabilities and failure mechanisms of the micro oven at the GTS-LHC ECR ion source at CERN

2020

The GTS-LHC ECR ion source (named after the Grenoble Test Source and the Large Hadron Collider) at CERN provides heavy ion beams for the chain of accelerators from Linac3 up to the LHC for high energy collision experiments and to the Super Proton Synchrotron for fixed target experiments. During the standard operation, the oven technique is used to evaporate lead into the source plasma to produce multiple charged lead ion beams. Intensity and stability are key parameters for the beam, and the operational experience is that some of the source instabilities can be linked to the oven performance. Over long operation periods of several weeks, the evaporation is not stable which makes the tuning …

010302 applied physicsRange (particle radiation)Large Hadron ColliderMaterials scienceionitNuclear engineeringEvaporationPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesSuper Proton SynchrotronIon source010305 fluids & plasmasIonComputer Science::OtherPhysics::Popular Physics0103 physical scienceslyijyInstrumentationBeam (structure)
researchProduct

Overview of the JET preparation for deuterium-tritium operation with the ITER like-wall

2019

Documento escrito por un elevado número de autores/as, sólo se referencia el/la que aparece en primer lugar y los/as autores/as pertenecientes a la UC3M For the past several years, the JET scientific programme (Pamela et al 2007 Fusion Eng. Des. 82 590) has been engaged in a multi-campaign effort, including experiments in D, H and T, leading up to 2020 and the first experiments with 50%/50% D–T mixtures since 1997 and the first ever D–T plasmas with the ITER mix of plasma-facing component materials. For this purpose, a concerted physics and technology programme was launched with a view to prepare the D–T campaign (DTE2). This paper addresses the key elements developed by the JET programme d…

:Física [Ciências exactas e naturais]Nuclear engineeringPLASMASCONFINEMENTfusion power7. Clean energy01 natural sciences010305 fluids & plasmaslaw.inventionlawTRANSPORT EXPERIMENTSFusió nuclearMODESettore FIS/01Jet (fluid)fusion power ; JET ; tritium ; isotopeILW DIVERTORIsotopetritiumPhysicsSettore ING-IND/18 - Fisica dei Reattori NuclearimodeInjectorCondensed Matter PhysicsFusion Plasma and Space PhysicsSettore ING-IND/20 - Misure e Strumentazione Nucleariconfinementperformance[PHYS.PHYS.PHYS-FLU-DYN]Physics [physics]/Physics [physics]/Fluid Dynamics [physics.flu-dyn]Nuclear and High Energy PhysicsTechnology and Engineeringfusion power; JET; tritium; isotopetransport experimentsPlasma (Gasos ionitzats)Tritium114 Physical sciencesFísica FísicaFusion plasma och rymdfysik:Physical sciences [Natural sciences]0103 physical sciencesThermalFusion powerFusiónNeutronddc:530010306 general physicsisotopePhysics Physical sciencesQC717fusion power; isotope; JET; tritiumPlasma (Ionized gases)Spectrometer:Física [Àrees temàtiques de la UPC]FísicaPlasmaFusion powerPERFORMANCEplasmasilw divertorHigh-confinement mode13. Climate actionJetJETEnvironmental scienceNuclear fusion
researchProduct

Ion–Molecule Rate Constants for Reactions of Sulfuric Acid with Acetate and Nitrate Ions

2022

Atmospheric nucleation from precursor gases is a significant source of cloud condensation nuclei in the troposphere and thus can affect the Earth's radiative balance. Sulfuric acid, ammonia, and amines have been identified as key nucleation precursors in the atmosphere. Studies have also shown that atmospheric ions can react with sulfuric acid to form stable clusters in a process referred to as ion-induced nucleation (IIN). IIN follows similar reaction pathways as chemical ionization, which is used to detect and measure nucleation precursors via atmospheric pressure chemical ionization mass spectrometers. The rate at which ions form clusters depends on the ion-molecule rate constant. Howeve…

ACETIC-ACIDSCOLLISIONSDIMETHYLAMINEanionitionitsulfuric acidkinetic parametersAEROSOLCOSMIC-RAYS114 Physical sciencesCHEMICAL-IONIZATIONPARTICLE FORMATIONionsPhysical and Theoretical ChemistryORGANIC-ACIDSanionsorganic compoundsorgaaniset yhdisteetCARBOXYLIC-ACIDSNUCLEATIONThe Journal of Physical Chemistry A
researchProduct

The effect of antenatal intravenous immunoglobulin on ascending intrauterine infection after preterm premature rupture of the membranes: a pilot study

1992

Ascending infection is a serious threat in pregnancies complicated by preterm premature rupture of the membranes (PROM). In a controlled randomized prospective pilot study (n = 18) we have evaluated the effect of intravenous IgM enriched immunoglobulin given to the mothers 24-48 hours after preterm PROM in reducing ascending infection. Using a validated infection score from laboratory and clinical data at birth, we found a significant reduction of probable infection in the neonates of the treatment group compared to the control group (p = 0.0022). Histopathological investigation of the placentas, membranes and umbilical cords revealed significantly lower stages and grades of chorioamnioniti…

AdultFetal Membranes Premature Rupturemedicine.medical_specialtyPromChorioamnionitisInfant Newborn Diseaseslaw.inventionRandomized controlled trialPregnancylawHumansMedicineProspective StudiesPregnancy Complications InfectiousProspective cohort studyUterine DiseasesPregnancybusiness.industryObstetricsInfant NewbornImmunoglobulins IntravenousObstetrics and GynecologyBacterial Infectionsmedicine.diseaseClinical trialPediatrics Perinatology and Child HealthCohortFemalebusinessComplicationjpme
researchProduct

Effects of leptin on lipopolysaccharide-induced myometrial apoptosis in an in vitro human model of chorioamnionitis.

2011

Objective This study was aimed at assessing the role of leptin on human myometrium, by studying its receptor expression in pregnant myometrium and the interaction of leptin with inflammation-induced apoptosis. Study Design Myometrial samples were obtained from women with uncomplicated pregnancies who underwent cesarean delivery at term before labor onset. The effect of leptin on apoptosis was assessed by the incubation of myometrial strips with leptin (10 –10 to 10 –8 mol/L; 48 hours) before lipopolysaccharide treatment (10 μg/mL; 48 hours). Results Long and short leptin receptor isoforms were expressed in myometrial cells of pregnant women. Leptin prevented lipopolysaccharide-induced apopt…

AdultLeptinLipopolysaccharidesmedicine.medical_specialtyLipopolysaccharideReceptor expressionApoptosisIn Vitro TechniquesChorioamnionitischemistry.chemical_compoundYoung AdultPregnancyInternal medicinemedicineHumansLeptin receptorbusiness.industryLeptindigestive oral and skin physiologyMyometriumObstetrics and Gynecologymedicine.diseaseEndocrinologyChorioamnionitischemistryApoptosisMyometriumReceptors LeptinFemaleSignal transductionbusinesshormones hormone substitutes and hormone antagonistsAmerican journal of obstetrics and gynecology
researchProduct

Effect of probiotics on vaginal health in pregnancy. EFFPRO, a randomized controlled trial

2016

Background Preterm delivery is a leading cause of neonatal morbidity and death. It often results from chorioamnionitis, which is a complication of bacterial vaginosis. Probiotics are effective in the treatment of bacterial vaginosis in women who were not pregnant; studies in pregnant woman are missing. Objective The purpose of this study was to evaluate whether an oral probiotic food supplement supports the maintenance or restoration of a normal vaginal microbiota during pregnancy. Study Design We conducted a randomized, placebo-controlled, triple-blind, parallel group trial. Oral Lactobacillus rhamnosus GR-1and L reuteri RC-14 (10 9 colony-forming units) or placebo were administered for 8 …

AdultLimosilactobacillus reuterimedicine.medical_specialtyAdministration OralChorioamnionitisPlacebolaw.inventionYoung Adult03 medical and health sciencesProbiotic0302 clinical medicineLactobacillus rhamnosusRandomized controlled trialPregnancylawmedicineHumans030212 general & internal medicinePregnancy030219 obstetrics & reproductive medicinebiologyLacticaseibacillus rhamnosusObstetricsbusiness.industryMicrobiotaProbioticsObstetrics and GynecologyMiddle Agedbiology.organism_classificationmedicine.diseasePregnancy Trimester Firstmedicine.anatomical_structureVaginaVaginaFemaleBacterial vaginosisbusinessAmerican Journal of Obstetrics and Gynecology
researchProduct

Changes in Maternal Blood Inflammatory Markers As a Predictor Of Chorioamnionitis: A Prospective Multicenter Study

2014

Problem To evaluate the inflammatory pattern in maternal circulation from women with preterm premature rupture of membranes (PPROM) considering the occurrence of histologically confirmed chorioamnionitis (HCA). Method of study A prospective study was conducted in 121 women with PPROM between 24 and 34 + 0 weeks of gestation. Association between white blood cells (WBC) count, plasma CRP, IL-6, MCP-1 and IP-10 levels, and HCA was assessed. Results The rate of HCA was 44.7% (54/121). During the 5 days preceding delivery, median CRP, WBC, and IL-6 levels were significantly higher in the HCA than in no-HCA group (P < 0.001). Variations in IL-6, IP-10 levels, during the 24–72 hr before delivery, …

Adultmedicine.medical_specialtyPathologyImmunologyChorioamnionitisGastroenterologyLeukocyte CountObstetric Labor PrematurePredictive Value of TestsPregnancyInternal medicinemedicineHumansImmunology and AllergyPlacental CirculationAmnionProspective StudiesProspective cohort studyRupturePregnancybiologybusiness.industryC-reactive proteinArea under the curveObstetrics and GynecologyPrognosismedicine.diseaseC-Reactive ProteinChorioamnionitisReproductive MedicinePredictive value of testsbiology.proteinCytokinesGestationFemaleInflammation MediatorsbusinessPremature rupture of membranesBiomarkersFollow-Up StudiesAmerican Journal of Reproductive Immunology
researchProduct

Application of Pinhole Plasma Jet Activated Water against Escherichia coli, Colletotrichum gloeosporioides, and Decontamination of Pesticide Residues…

2022

Plasma activated water (PAW) generated from pinhole plasma jet using gas mixtures of argon (Ar) and 2% oxygen (O2) was evaluated for pesticide degradation and microorganism decontamination (i.e., Escherichia coli and Colletotrichum gloeosporioides) in chili (Capsicum annuum L.). A flow rate of 10 L/min produced the highest concentration of hydrogen peroxide (H2O2) at 369 mg/L. Results showed that PAW treatment for 30 min and 60 min effectively degrades carbendazim and chlorpyrifos by about 57% and 54% in solution, respectively. In chili, carbendazim and chlorpyrifos were also decreased, to a major extent, by 80% and 65% after PAW treatment for 30 min and 60 min, respectively. E. coli popula…

AlimentacióHealth (social science)Aliments ContaminacióPlaguicidesPlant SciencePlasma (Gasos ionitzats)pesticides; cold plasma; decontamination; plasma activated water; chili (<i>Capsicum annuum</i> L.); pinhole plasma jetHealth Professions (miscellaneous)MicrobiologyFood Science
researchProduct

Synthesis and Redox Behaviour of the Chalcogenocarbonyl Dianions, [(E)C(PPh2S)2]2−: Formation and Structures of Chalcogen−Chalcogen Bonded Dimers and…

2010

The lithium salts of the chalcogenocarbonyl dianions [(E)C(PPh(2)S)(2)](2-) (E=S (4 b), Se (4 c)) were produced through the reactions between Li(2)[C(PPh(2)S)(2)] and elemental chalcogens in the presence of tetramethylethylenediamine (TMEDA). The solid-state structure of {[Li(TMEDA)](2)[(Se)C(PPh(2)S)(2)]}-[{Li(TMEDA)}(2)4 c]-was shown to be bicyclic with the Li(+) cations bis-S,Se-chelated by the dianionic ligand. One-electron oxidation of the dianions 4 b and 4 c with iodine afforded the diamagnetic complexes {[Li(TMEDA)](2)[(SPh(2)P)(2)CEEC(PPh(2)S)(2)]} ([Li(TMEDA)](2)7 b (E=S), [Li(TMEDA)](2)7 c (E=Se)), which are formally dimers of the radical anions [(E)C(PPh(2)S)(2)](-) (.) (E=S (5 …

Bicyclic moleculeLigandStereochemistryOrganic ChemistryProtonationGeneral ChemistryTetramethylethylenediamineCrystal structureCatalysisAdductchemistry.chemical_compoundCrystallographyChalcogenchemistrychalcogenocarbonyl dianionskalkogeenikarbonyylidianionitSelone
researchProduct