Search results for "ionit"

showing 10 items of 142 documents

The ion-optical design of the MARA recoil separator and absolute transmission measurements of the RITU gas-filled recoil separator

2011

In this thesis work, the use of two complementary recoil separators for studies of nuclear structure via fusion-evaporation reactions are discussed. The design and the main ion-optical properties of the vacuum-mode recoil-mass separator MARA, intended for studies of nuclei with N Z close to the proton drip-line, are presented. MARA (Mass Analysing Recoil Apparatus) consists of a magnetic quadrupole triplet followed by an electrostatic de ector and a magnetic dipole. The working principle of MARA is discussed and the reasons for the choice of the optical parameters of the elements are given. The performance of MARA for di erent kind of fusion reactions has been studied with Monte Carlo simul…

ionitrecoil separator modellingconvolutiongas-filled recoil separatorion opticsrecoil separatoroptiikka
researchProduct

RITU:n kehittäminen ja kaasutäytteisiin separaattoreihin liittyvää ionioptiikkaa

2004

ionitrekyyliseparaattoritsähkömagneetitoptiikka
researchProduct

ECR-ionilähteen tuottaman röntgensäteilyn simulointi

2008

ionitröntgensäteilysimulointihiukkaskiihdyttimetplasmafysiikka
researchProduct

Central Region Upgrade for the Jyväskylä K130 Cyclotron

2020

The Jyväskylä K130 cyclotron has been in operation for more than 25 years providing beams from H to Au with energies ranging from 1 to 80 MeV/u for nuclear physics research and applications. At the typical energies around 5 MeV/u used for the nuclear physics program the injection voltage used is about 10 kV. The low voltage limits the beam intensity especially from the 18 GHz ECRIS HIISI. To increase the beam intensities the central region of the K130 cyclotron is being upgraded by increasing the injection voltage by a factor of 2. The new central region with spiral inflectors for harmonics 1-3 has been designed. The new central region shows better transmission in simulations than the origi…

ionitsyklotronit04 Operation and UpgradeshiukkaskiihdyttimetAccelerator Physics
researchProduct

Dijet studies with ALICE at the LHC

2020

Relativistisissa hiukkastörmäyksissä syntyvistä suurenergisistä kvarkeista ja gluoneista, eli partoneista, muodostuvaa hyvin kollimoitunutta hiukkassuihkua kutsutaan jetiksi. Jettien tutkimusta on tehty jo vuosikaudet ja se hallitaan hyvin myös raskasionitörmäyksissä, joissa muodostuvaa kvarkkigluoniplasmaa on pystytty tutkimaan jettien liikemäärähäviöiden avulla. Tämän perusteella on huomattu, että kvarkkigluoniplasma jarruttaa sen läpi kulkevia suurenergisiä partoneita. Jettien lisäksi partonien energiahäviöitä raskasionitörmäyksessä on tutkittu myös dijettien avulla. Dijetti on määritelty törmäyksen kahdesta suurimman energian omaavasta jetistä muodostuvaksi systeemiksi. Aiempien RHIC- j…

jettien rekonstruktioALICEdijetin massarelativistinen raskasionitörmäysHigh Energy Physics::PhenomenologyenergiahäviöCERNHigh Energy Physics::ExperimentLHCNuclear ExperimentParticle Physics - Experiment
researchProduct

Fenyyli-ja metoksifenyylisubstituoidut karbokationit katalyytteinä

2018

Karbokationit ovat orgaanisia molekyylejä, joissa on positiivisesti varautunut hiiliatomi. Hybridisaatioteoria selittää karbokationien luonnetta ja kolmiulotteista rakennetta keskushiilen sp2-hybridisaatiolla, jossa hiiliatomin hybridisoitumaton p-orbitaali levittäytyy kolmen hybridiorbitaalin muodostaman tason ylä- ja alapuolille. Hybridisoitumaton porbitaali ei kuitenkaan ole täysin eristyksissä hybridisoituneista sidosorbitaaleista vaan se vastaanottaa helposti elektronitiheyttä keskushiileen sitoutuneilta substituenteilta. Mitä enemmän substituentit luovuttavat elektronitiheyttä positiivisesti varautuneelle hiiliatomille, sitä enemmän elektronitiheyttä siirtyy myös hybridisoitumattomall…

katalyytitkatalyysiorgaaninen kemiakarbokationit
researchProduct

Anion Responsive Molecular Switch Based on a Doubly‐Strapped Calix[4]pyrrole

2022

A calix[4]pyrrole receptor bearing two proximally meso - meso linking isophthaloyl straps displays open and closed states depending on the calix[4]pyrrole conformation. In the crystal structures and in non-polar solvent, the calix[4]pyrrole adopts open 1,3-alternate conformation with straps on the sides. Anion binding triggers a closed state of the receptor providing two types of interactions with an aromatic benzoate guest: hydrogen bonds from the pyrrolic groups and π ··· π interactions from the phenyl groups of the straps. Slow exchange dynamics was observed on the NMR timescale indicating that benzoate, acetate and chloride anions, which bind with relatively low affinity get kinetically…

kemialliset sidoksetNMR spectroscopyvetysidoksetanionitcalix[4]pyrrolessupramolekulaarinen kemiaNMR-spektroskopiaheterosykliset yhdisteetanionssupramolecular chemistrymolecular switch
researchProduct

Separation of atomic and molecular ions by ion mobility with an RF carpet

2021

Gas-filled stopping cells are used at accelerator laboratories for the thermalization of high-energy radioactive ion beams. Common challenges of many stopping cells are a high molecular background of extracted ions and limitations of extraction efficiency due to space-charge effects. At the FRS Ion Catcher at GSI, a new technique for removal of ionized molecules prior to their extraction out of the stopping cell has been developed. This technique utilizes the RF carpet for the separation of atomic ions from molecular contaminant ions through their difference in ion mobility. Results from the successful implementation and test during an experiment with a 600~MeV/u $^{124}$Xe primary beam are…

low-energy RIBPhysics - Instrumentation and DetectorsOrders of magnitude (temperature)beam purificationFOS: Physical sciences010402 general chemistrynucl-ex01 natural sciences530Ionmenetelmätion mobilityIonizationMoleculeddc:530Physical and Theoretical ChemistryfysiikkaNuclear Experiment (nucl-ex)Nuclear ExperimentInstrumentationphysics.ins-detSpectroscopyIon transporterRange (particle radiation)ionitChemistry010401 analytical chemistryExtraction (chemistry)gas cellpuhdistusInstrumentation and Detectors (physics.ins-det)Condensed Matter Physics0104 chemical sciencesmolecular contaminationBeamlinespace chargeAtomic physicserottaminen (tekniikka)epäpuhtaudet
researchProduct

Room-Temperature Magnetic Bistability in a Salt of Organic Radical Ions

2021

International audience; Cocrystallization of 7,7′,8,8′-tetracyanoquinodimethane radical anion (TCNQ −•) and 3-methylpyridinium-1,2,3,5dithiadiazolyl radical cation (3-MepyDTDA +•) afforded isostructural acetonitrile (MeCN) or propionitrile (EtCN) solvates containing cofacial π dimers of homologous components. Loss of lattice solvent from the diamagnetic solvates above 366 K affords a high-temperature paramagnetic phase containing discrete TCNQ −• and weakly bound π dimers of 3-MepyDTDA +• , as evidenced by X-ray diffraction methods and magnetic susceptibility measurements. Below 268 K, a first-order phase transition occurs, leading to a low-temperature diamagnetic phase with TCNQ −• σ dimer…

magneettiset ominaisuudetDimer02 engineering and technologyGeneral Chemistry[CHIM.MATE]Chemical Sciences/Material chemistry010402 general chemistry021001 nanoscience & nanotechnologyvapaat radikaalit01 natural sciencesBiochemistryTetracyanoquinodimethaneMagnetic susceptibilityCatalysis0104 chemical scienceschemistry.chemical_compoundParamagnetismCrystallographyColloid and Surface ChemistryRadical ionchemistryDiamagnetismPropionitrileIsostructural0210 nano-technologyorgaaniset yhdisteet
researchProduct

Molecular dynamics simulations of heavy ion induced defects in SiC Schottky diodes

2018

Heavy ion irradiation increases the leakage current in reverse-biased SiC Schottky diodes. This letter demonstrates, via molecular dynamics simulations, that a combination of bias and ion-deposited energy is required to produce the degradation. Peer reviewed

mallintaminenMaterials sciencePOWER DIODESSchottky diodesSINGLE-EVENT BURNOUT114 Physical sciences01 natural sciencesIonpower semiconductor devicesBARRIER DIODESTHERMAL-DAMAGEchemistry.chemical_compoundMolecular dynamicspuolijohteetsilicon carbide0103 physical sciencesSilicon carbideIrradiationElectrical and Electronic EngineeringSafety Risk Reliability and Quality010302 applied physicsta114ta213ionit010308 nuclear & particles physicsbusiness.industryionisoiva säteilyINORGANIC INSULATORSSchottky diodemodelingHeavy ion irradiationIRRADIATIONElectronic Optical and Magnetic MaterialschemistryionsOptoelectronicsDegradation (geology)Heavy ionbusinession radiation effectsIEEE Transactions on Device and Materials Reliability
researchProduct