Search results for "link"

showing 10 items of 1973 documents

Acute Effect of Alcohol Intake on Cardiovascular Autonomic Regulation During the First Hours of Sleep in a Large Real-World Sample of Finnish Employe…

2018

Background Sleep is fundamental for good health, and poor sleep has been associated with negative health outcomes. Alcohol consumption is a universal health behavior associated with poor sleep. In controlled laboratory studies, alcohol intake has been shown to alter physiology and disturb sleep homeostasis and architecture. The association between acute alcohol intake and physiological changes has not yet been studied in noncontrolled real-world settings. Objective The aim of this study was to assess the effects of alcohol intake on the autonomic nervous system (ANS) during sleep in a large noncontrolled sample of Finnish employees. Methods From a larger cohort, this study included 4098 su…

medicine.medical_specialtysykeAlcoholuni (lepotila)03 medical and health scienceschemistry.chemical_compound0302 clinical medicinewearable electronic deviceInternal medicineHeart rateautonominen hermostomedicineheart rateHeart rate variability030212 general & internal medicinesleepta315Original Paperbusiness.industrysydänautonomic nervous systemheart rate variabilityRepeated measures designta3141217 Medical engineeringuni (biologiset ilmiöt)Sleep in non-human animalsalcohol drinkingPsychiatry and Mental healthchemistryCohortAnalysis of variancealkoholinkäyttöbusinessBody mass index030217 neurology & neurosurgeryJMIR Mental Health
researchProduct

Vaccination with ENO1 DNA Prolongs Survival of Genetically Engineered Mice with Pancreatic Cancer

2013

Background & Aims Pancreatic ductal adenocarcinoma (PDA) is an aggressive tumor, and patients typically present with late-stage disease; rates of 5-year survival after pancreaticoduodenectomy are low. Antibodies against α-enolase (ENO1), a glycolytic enzyme, are detected in more than 60% of patients with PDA, and ENO1-specific T cells inhibit the growth of human pancreatic xenograft tumors in mice. We investigated whether an ENO1 DNA vaccine elicits antitumor immune responses and prolongs survival of mice that spontaneously develop autochthonous, lethal pancreatic carcinomas. Methods We injected and electroporated a plasmid encoding ENO1 (or a control plasmid) into Kras G12D /Cre (KC) mice …

medicine.medical_treatmentDNA Vaccine; Enolase; Parnceratic cancer; Transgeneic miceEnolasegenetically engineered miceceEnzyme-Linked Immunosorbent AssayTransgeneic miceDNA vaccination03 medical and health sciencesMice0302 clinical medicineImmune systemPancreatic cancerGenetic modelmedicineVaccines DNADNA VaccineAnimalsSurvival rate030304 developmental biology0303 health sciencesImmunity CellularHepatologybiologyENO.1; DNA Vaccine; genetically engineered miceceVaccinationGastroenterologyParnceratic cancerImmunotherapyNeoplasms Experimentalmedicine.diseaseImmunohistochemistryMice Mutant Strains3. Good healthPancreatic NeoplasmsSurvival RateSettore BIO/18 - GeneticaTumor progression030220 oncology & carcinogenesisPhosphopyruvate HydrataseImmunologybiology.proteinAntibodyENO.1Carcinoma Pancreatic Ductal
researchProduct

Induction of Type-Specific Neutralizing Antibodies by Capsomeres of Human Papillomavirus Type 33

2001

Abstract The immunogenicity of capsomeres of human papillomavirus type 33 was evaluated in a dose–response analysis. Capsomeres were obtained free of capsids by expression of L1 carrying the single point mutation C427S. Neutralizing antibodies were detected using an in vitro pseudoinfection assay. Capsomeres induced type-specific, neutralizing antibodies in mice even in the absence of adjuvant. The neutralization titers of immune sera raised without adjuvant were 10- to 20-fold lower than those of antisera to virus-like particles, but virtually identical using Freund's adjuvant. These data indicate that capsomeres may substitute for virus-like particles in future vaccines when used with an …

medicine.medical_treatmentDose-Response Relationship ImmunologicEnzyme-Linked Immunosorbent AssayAntibodies ViralpapillomavirusNeutralizationMiceCapsidNeutralization Testsdose responseVirologymedicineAnimalsHumansPapillomaviridaeAntiserumMice Inbred BALB CbiologyImmunogenicityCapsomereVirionneutralizationvaccinationVirologyTiterCapsidbiology.proteincapsomeresImmunizationAntibodyAdjuvantVirology
researchProduct

CpG-Loaded Multifunctional Cationic Nanohydrogel Particles as Self-Adjuvanting Glycopeptide Antitumor Vaccines

2014

Self-adjuvanting antitumor vaccines by multifunctional cationic nanohydrogels loaded with CpG. A conjugate consisting of tumor-associated MUC1-glycopeptide B-cell epitope and tetanus toxin T-cell epitope P2 is linked to cationic nanogels. Oligonucleotide CpG complexation enhances toll-like receptor (TLR) stimulated T-cell proliferation and rapid immune activation. This co-delivery promotes induction of specific MUC1-antibodies binding to human breast tumor cells without external adjuvant.

medicine.medical_treatmentMolecular Sequence DataBiomedical EngineeringPharmaceutical ScienceEnzyme-Linked Immunosorbent Assaymedicine.disease_causeCancer VaccinesHydrogel Polyethylene Glycol DimethacrylateEpitopeBiomaterialsAdjuvants ImmunologicCationsmedicineAnimalsHumansAmino Acid SequenceReceptorMice Inbred BALB COligonucleotideToxinChemistryGlycopeptidesGlycopeptideOligodeoxyribonucleotidesCpG siteImmunologyCancer researchNanoparticlesAdjuvantConjugateAdvanced Healthcare Materials
researchProduct

Sokean signaalinkäsittelyn menetelmiä : sovelluksena EEG-aineiston analysointi

2011

menetelmätAMUSESOBIsignaalinkäsittelytilastotiederiippumattomien komponenttien analyysi
researchProduct

Rtęć w surowcach do produkcji cementu i pyłach powstających w tym procesie

2010

mercurypyły cementoweclinker burningwypalanie klinkierucement dustsrtęć
researchProduct

Tyttöjen karnevalistinen humala : tulkintoja tyttöjen alkoholikulttuurista

2001

merkityksetmielipiteetkarnevaalitalkoholinkäyttöalkoholitytötsukupuolikirjoittaminen
researchProduct

Determination of the Time Window of Event-Related Potential Using Multiple-Set Consensus Clustering

2020

Clustering is a promising tool for grouping the sequence of similar time-points aimed to identify the attention blocks in spatiotemporal event-related potentials (ERPs) analysis. It is most likely to elicit the appropriate time window for ERP of interest if a suitable clustering method is applied to spatiotemporal ERP. However, how to reliably estimate a proper time window from entire individual subjects’ data is still challenging. In this study, we developed a novel multiset consensus clustering method in which several clustering results of multiple subjects were combined to retrieve the best fitted clustering for all the subjects within a group. Then, the obtained clustering was processed…

microstates analysiscognitive neurosciencetime-windowsignaalinkäsittelyGeneral Neurosciencesignaalianalyysimulti-set consensus clusteringtime windowklusterianalyysikognitiivinen neurotiedeevent-related potentials
researchProduct

Consistency of Independent Component Analysis for FMRI

2021

Background Independent component analysis (ICA) has been widely used for blind source separation in the field of medical imaging. However, despite of previous substantial efforts, the stability of ICA components remains a critical issue which has not been adequately addressed, despite numerous previous efforts. Most critical is the inconsistency of some of the extracted components when ICA is run with different model orders (MOs). New Method In this study, a novel method of determining the consistency of component analysis (CoCA) is proposed to evaluate the consistency of extracted components with different model orders. In the method, “consistent components” (CCs) are defined as those whic…

model ordertoiminnallinen magneettikuvausconsistencysignaalinkäsittelyfMRIsignaalianalyysiICA
researchProduct

Synthesis and application of orthogonal signal bases possessing enhanced timefrequency localization for mobile wireless networks

2012

multipleksointimultiplexingsignaalinkäsittelykanavointisignaalianalyysitiedonsiirtolocalizationfilter banklangaton tiedonsiirtoalgoritmitmulti-carriersignaalitPHYsignal processingpulse-shapingOFDM
researchProduct