Search results for "ong"

showing 10 items of 9299 documents

Józef Wacław Dąbrowski (1797–1862). Wołynianin w armii Królestwa Polskiego

2021

W artykule, w oparciu o nieznane i tym samym niewykorzystywane dotąd przez historyków wspomnienia, przedstawione zostały dzieciństwo i młodość Józefa Wacława Dąbrowskiego, oficera wojska Królestwa Polskiego, dowódcę w randze kapitana i majora oddziałów powstańczych jesienią 1830 – latem 1831 r. Koleje jego losów i kariera wojskowa są tak typowe, jak i odbiegające od znanych i omawianych w literaturze przedmiotu schematów. Typowe, gdyż dzięki wywodzeniu się z kręgów średnio zamożnego ziemiaństwa rozpoczął służbę wojskową od stopnia kadeta, aby przed upływem roku awansować na podchorążego i uzyskać skierowanie do szkoły podchorążych, stanowiącej niezbędny etap służby potrzebny do awansu ofice…

(Congress) Kingdom of Polandpowstanie listopadoweWołyńDąbrowski familyKrólestwo Polskie (kongresowe)Volhyniaarmy of the Kingdom of PolandPolish landed gentry of the 19th centurypolskie ziemiaństwo początku XIX w.Generals of the Kingdom of Polandwojsko Królestwa PolskiegoNovember Uprisingrodzina Dąbrowskichgeneralicja Królestwa PolskiegoEcha Przeszłości
researchProduct

Colloquium: Nonequilibrium effects in superconductors with a spin-splitting field

2018

This Colloquium discusses the recent progress in understanding the properties of spin-split superconductors under nonequilibrium conditions. Recent experiments and theories demonstrate a rich variety of transport phenomena occurring in devices based on such materials that suggest direct applications in thermoelectricity, low-dissipative spintronics, radiation detection, and sensing. This text discusses different experimental situations and presents a theoretical framework based on quantum kinetic equations. This framework provides an accurate description of the nonequilibrium distribution of charge, spin, and energy, which are the relevant nonequilibrium modes, in different hybrid structure…

---General Physics and AstronomyLibrary scienceFOS: Physical sciences02 engineering and technologysuperconductors01 natural sciences7. Clean energysuprajohteetSuperconductivity (cond-mat.supr-con)Spin splitting0103 physical sciencesMesoscale and Nanoscale Physics (cond-mat.mes-hall)media_common.cataloged_instanceEuropean union010306 general physicskvanttifysiikkamedia_commonPhysicsCondensed Matter - Mesoscale and Nanoscale PhysicsCondensed Matter - SuperconductivityEuropean research021001 nanoscience & nanotechnologyquantum physicsCondensed Matter::Strongly Correlated Electrons0210 nano-technology
researchProduct

Spin filtering by proximity effects at hybridized interfaces in spin-valves with 2D graphene barriers

2020

We report on spin transport in state-of-the-art epitaxial monolayer graphene based 2D-magnetic tunnel junctions (2D-MTJs). In our measurements, supported by ab-initio calculations, the strength of interaction between ferromagnetic electrodes and graphene monolayers is shown to fundamentally control the resulting spin signal. In particular, by switching the graphene/ferromagnet interaction, spin transport reveals magneto-resistance signal MR > 80% in junctions with low resistance × area products. Descriptions based only on a simple K-point filtering picture (i.e. MR increase with the number of layers) are not sufficient to predict the behavior of our devices. We emphasize that hybridization …

/120Materials scienceScienceGeneral Physics and AstronomyGenetics and Molecular Biology02 engineering and technologyMaterials science Nanoscience and technology010402 general chemistry01 natural sciencesSignalArticleGeneral Biochemistry Genetics and Molecular Biologylaw.inventionEngineeringNanoscience and technologylawMonolayerProximity effect (superconductivity)/128/639/925[PHYS.COND]Physics [physics]/Condensed Matter [cond-mat]lcsh:ScienceSpin-½[PHYS]Physics [physics]/639/166/639/301MultidisciplinarySpintronicsCondensed matter physicsNanotecnologiaGraphenePhysicsQ/639/766General ChemistryCiència dels materials5104 Condensed Matter Physics021001 nanoscience & nanotechnologyMaterials science0104 chemical sciencesFerromagnetismGeneral BiochemistryDensity of stateslcsh:QCondensed Matter::Strongly Correlated Electrons/1190210 nano-technology51 Physical SciencesNature Communications
researchProduct

Inverse problems for $p$-Laplace type equations under monotonicity assumptions

2016

We consider inverse problems for $p$-Laplace type equations under monotonicity assumptions. In two dimensions, we show that any two conductivities satisfying $\sigma_1 \geq \sigma_2$ and having the same nonlinear Dirichlet-to-Neumann map must be identical. The proof is based on a monotonicity inequality and the unique continuation principle for $p$-Laplace type equations. In higher dimensions, where unique continuation is not known, we obtain a similar result for conductivities close to constant.

010101 applied mathematicsunique continuation principleMathematics - Analysis of PDEsinverse problems010102 general mathematicsFOS: MathematicsDirichlet-to-Neumann map35J92 35R300101 mathematics01 natural sciencesp-Laplace equationinversio-ongelmatAnalysis of PDEs (math.AP)
researchProduct

Spin Hall magnetoresistance in antiferromagnetic insulators

2020

Antiferromagnetic materials promise improved performance for spintronic applications, as they are robust against external magnetic field perturbations and allow for faster magnetization dynamics compared to ferromagnets. The direct observation of the antiferromagnetic state, however, is challenging due to the absence of a macroscopic magnetization. Here, we show that the spin Hall magnetoresistance (SMR) is a versatile tool to probe the antiferromagnetic spin structure via simple electrical transport experiments by investigating the easy-plane antiferromagnetic insulators $\alpha$-Fe2O3 (hematite) and NiO in bilayer heterostructures with a Pt heavy metal top electrode. While rotating an ext…

010302 applied physicsCondensed Matter - Materials ScienceMagnetization dynamicsMaterials scienceMagnetoresistanceSpintronicsCondensed matter physicsMaterials Science (cond-mat.mtrl-sci)FOS: Physical sciencesGeneral Physics and Astronomy02 engineering and technology021001 nanoscience & nanotechnology01 natural sciencesMagnetic fieldMagnetizationFerromagnetismFerrimagnetism0103 physical sciencesAntiferromagnetismCondensed Matter::Strongly Correlated Electrons0210 nano-technologyJournal of Applied Physics
researchProduct

An insulating doped antiferromagnet with low magnetic symmetry as a room temperature spin conduit

2020

We report room temperature long-distance spin transport of magnons in antiferromagnetic thin film hematite doped with Zn. The additional dopants significantly alter the magnetic anisotropies, resulting in a complex equilibrium spin structure that is capable of efficiently transporting spin angular momentum at room temperature without the need for a well-defined, pure easy-axis or easy-plane anisotropy. We find intrinsic magnon spin-diffusion lengths of up to 1.5 {\mu}m, and magnetic domain governed decay lengths of 175 nm for the low frequency magnons, through electrical transport measurements demonstrating that the introduction of non-magnetic dopants does not strongly reduce the transport…

010302 applied physicsCondensed Matter - Materials ScienceMaterials scienceCondensed Matter - Mesoscale and Nanoscale PhysicsPhysics and Astronomy (miscellaneous)Magnetic domainCondensed matter physicsMagnetoresistanceMagnonMaterials Science (cond-mat.mtrl-sci)FOS: Physical sciences02 engineering and technologySpin structure021001 nanoscience & nanotechnology01 natural sciencesCondensed Matter::Materials ScienceMesoscale and Nanoscale Physics (cond-mat.mes-hall)0103 physical sciencesMagnetic dampingAntiferromagnetismCondensed Matter::Strongly Correlated Electrons0210 nano-technologyAnisotropySpin (physics)Applied Physics Letters
researchProduct

Large Zero-Field Cooled Exchange-Bias in BulkMn2PtGa

2013

We report a large exchange-bias (EB) effect after zero-field cooling the new tetragonal Heusler compound Mn2PtGa from the paramagnetic state. The first-principle calculation and the magnetic measurements reveal that Mn2PtGa orders ferrimagnetically with some ferromagnetic (FM) inclusions. We show that ferrimagnetic (FI) ordering is essential to isothermally induce the exchange anisotropy needed for the zero-field cooled (ZFC) EB during the virgin magnetization process. The complex magnetic behavior at low temperatures is characterized by the coexistence of a field induced irreversible magnetic behavior and a spin-glass-like phase. The field induced irreversibility originates from an unusual…

010302 applied physicsCondensed Matter - Materials ScienceMaterials scienceMagnetic domainCondensed matter physicsMaterials Science (cond-mat.mtrl-sci)FOS: Physical sciencesGeneral Physics and Astronomy02 engineering and technologyengineering.material021001 nanoscience & nanotechnologyHeusler compound01 natural sciencesCondensed Matter::Materials ScienceParamagnetismMagnetic anisotropyMagnetizationExchange biasFerrimagnetism0103 physical sciencesengineeringAntiferromagnetismCondensed Matter::Strongly Correlated Electrons0210 nano-technologyPhysical Review Letters
researchProduct

Effective strain manipulation of the antiferromagnetic state of polycrystalline NiO

2021

As a candidate material for applications such as magnetic memory, polycrystalline antiferromagnets offer the same robustness to external magnetic fields, THz spin dynamics, and lack of stray field as their single crystalline counterparts, but without the limitation of epitaxial growth and lattice matched substrates. Here, we first report the detection of the average Neel vector orientiation in polycrystalline NiO via spin Hall magnetoresistance (SMR). Secondly, by applying strain through a piezo-electric substrate, we reduce the critical magnetic field required to reach a saturation of the SMR signal, indicating a change of the anisotropy. Our results are consistent with polycrystalline NiO…

010302 applied physicsCondensed Matter - Materials ScienceMaterials sciencePhysics and Astronomy (miscellaneous)Condensed matter physicsMagnetoresistanceMaterials Science (cond-mat.mtrl-sci)FOS: Physical sciencesMagnetostriction02 engineering and technology021001 nanoscience & nanotechnology01 natural sciencesMagnetic fieldCondensed Matter::Materials Science0103 physical sciencesAntiferromagnetismCondensed Matter::Strongly Correlated ElectronsCrystallite0210 nano-technologyAnisotropySaturation (magnetic)Spin-½Applied Physics Letters
researchProduct

A study of the optical effect of plasma sheath in a negative ion source using IBSIMU code

2020

A plasma sheath inside an ion source has a strong focusing effect on the formation of an ion beam from the plasma. Properties of the beam depend on the shape and location of the plasma sheath inside the source. The most accessible experimental data dependent on the plasma sheath are the beam phase space distribution. Variation of beam emittance is a reflection of the properties of the plasma sheath, with minimum emittance for the optimal shape of the plasma sheath. The location and shape of the plasma sheath are governed by complex physics and can be understood by simulations using plasma models in particle tracking codes like IBSimu. In the current study, a model of the D-Pace’s TRIUMF lic…

010302 applied physicsDebye sheathMaterials scienceIon beamPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesIon sourcenegative ion source010305 fluids & plasmassymbols.namesakeplasma sheathPhysics::Plasma Physics0103 physical sciencesPhysics::Space PhysicssymbolsPhysics::Accelerator PhysicsThermal emittanceStrong focusingBeam emittanceAtomic physicsInstrumentationBeam (structure)
researchProduct

Pressure-induced insulator-to-metal transition in α-SnWO4

2016

In-situ high-pressure W L1 and L3 edges x-ray absorption and mid-infrared spectroscopies complemented by first-principles calculations suggest the existence of pressure- induced insulator-to-metal transition in α-SnWO4 in the range of 5-7 GPa. Its origin is explained by a symmetrization of metal-oxygen octahedra due to a strong interaction of Sn 5s, W 5d and O 2p states along the b-axis direction, leading to a collapse of the band gap.

010302 applied physicsHistoryCondensed matter physicsAbsorption spectroscopyBand gapChemistryStrong interactionchemistry.chemical_element02 engineering and technology021001 nanoscience & nanotechnology01 natural sciencesSpectral lineComputer Science ApplicationsEducationMetalOctahedronvisual_art0103 physical sciencesvisual_art.visual_art_medium0210 nano-technologySpectroscopyTinJournal of Physics: Conference Series
researchProduct