Search results for "other"

showing 10 items of 12132 documents

Investigation on partial discharges in HVDC cables after polarity reversal events

2020

Due to the accumulation of space charge inside the insulating layer of HVDC cables, the electric field under load conditions may be altered compared to what is established in HVAC cables. For example, a high thermal gradient leads to the inversion of the electric field pattern until the maximum value is reached in proximity of the dielectric-semicon interfaces. These maximum values can be further increased due to transient overvoltages and polarity reversal events until reaching electric field values higher than the rated ones. The main goal of this research is to investigate the possibility that, during these transient phenomena, conditions are created that favor the occurrence of partial …

010302 applied physicsPolarity reversalMaterials science0211 other engineering and technologies02 engineering and technologyMechanics01 natural sciencesSpace chargeHVDC cable Polarity reversal HVDC joint Space chargeTemperature gradientSettore ING-IND/31 - ElettrotecnicaElectric field0103 physical sciencesPartial dischargeThermal021108 energyTransient (oscillation)Energy (signal processing)
researchProduct

Lead evaporation instabilities and failure mechanisms of the micro oven at the GTS-LHC ECR ion source at CERN

2020

The GTS-LHC ECR ion source (named after the Grenoble Test Source and the Large Hadron Collider) at CERN provides heavy ion beams for the chain of accelerators from Linac3 up to the LHC for high energy collision experiments and to the Super Proton Synchrotron for fixed target experiments. During the standard operation, the oven technique is used to evaporate lead into the source plasma to produce multiple charged lead ion beams. Intensity and stability are key parameters for the beam, and the operational experience is that some of the source instabilities can be linked to the oven performance. Over long operation periods of several weeks, the evaporation is not stable which makes the tuning …

010302 applied physicsRange (particle radiation)Large Hadron ColliderMaterials scienceionitNuclear engineeringEvaporationPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesSuper Proton SynchrotronIon source010305 fluids & plasmasIonComputer Science::OtherPhysics::Popular Physics0103 physical scienceslyijyInstrumentationBeam (structure)
researchProduct

Simplified feedback control system for scanning tunneling microscopy

2021

A Scanning Tunneling Microscope (STM) is one of the most important scanning probe tools available to study and manipulate matter at the nanoscale. In a STM, a tip is scanned on top of a surface with a separation of a few \AA. Often, the tunneling current between tip and sample is maintained constant by modifying the distance between the tip apex and the surface through a feedback mechanism acting on a piezoelectric transducer. This produces very detailed images of the electronic properties of the surface. The feedback mechanism is nearly always made using a digital processing circuit separate from the user computer. Here we discuss another approach, using a computer and data acquisition thr…

010302 applied physicsSuperconductivityPhysics - Instrumentation and DetectorsMaterials sciencebusiness.industrySerial communicationFOS: Physical sciencesWeyl semimetalPort (circuit theory)Instrumentation and Detectors (physics.ins-det)01 natural sciencesPiezoelectricityNoise (electronics)law.inventionCondensed Matter - Other Condensed MatterData acquisitionlawCondensed Matter::Superconductivity0103 physical sciencesOptoelectronicsScanning tunneling microscope010306 general physicsbusinessInstrumentationOther Condensed Matter (cond-mat.other)Review of Scientific Instruments
researchProduct

Electrochemical deposition of aniline derivatives for conductometric gas sensors

2019

International audience; Polymer film of poly(2,3,5,6-tetrafluoroaniline) (PTFA) were electroplated on ITO substrate from acidic medium by chronoamperometry. Electrochemical and morphological characterizations were performed and compared to polyaniline properties similarly coated. It seemed that PTFA film had an irreversible redox response with poor conductivity due to the absence of acid-base doping. This film were then incorporated in a patented device called MSDI heterojunction to perform ammonia sensing in humid atmosphere.

010302 applied physicschemistry.chemical_classificationMaterials scienceheterojunctionHeterojunction02 engineering and technologyPolymerConductivityChronoamperometry021001 nanoscience & nanotechnologyElectrochemistryammonia01 natural sciencespolyanilineconductometric sensorschemistry.chemical_compound[CHIM.POLY]Chemical Sciences/PolymersAnilineMonomerchemistryChemical engineering0103 physical sciencesPolyaniline[CHIM.OTHE]Chemical Sciences/Other0210 nano-technologyMaterials Today: Proceedings
researchProduct

Phosphasalen group IV metal complexes: synthesis, characterization and ring opening polymerization of lactide.

2020

International audience; We report the synthesis of a series of Zr and Ti complexes bearing phosphasalen which differs from salen by the incorporation of two P atoms in the ligand backbone. The reaction of phosphasalen proligands (1a-1c)H2 with Zr(CH2Ph)4 led to different products depending on the nature of the N,N-linker in the ligand. In case of ethylene-linked phosphasalen, octahedral Zr complex 2a formed as a single stereoisomer in trans geometry. With the phenylene linker, it was shown by dynamic NMR spectroscopy that complex 2b exists as a mixture of trans and cis-β isomers in solution, both enantiomers (Δ and Λ) of the cis-β isomer being in fast equilibrium with respect to the NMR tim…

010402 general chemistryLIGANDS SYNTHESIS01 natural sciencesRing-opening polymerizationCoordination complexInorganic ChemistryINDIUM COMPLEXESOctahedral molecular geometry[CHIM]Chemical SciencesSALALEN COMPLEXESCYCLIC ESTERSCOORDINATION CHEMISTRYZIRCONIUM COMPLEXES; COORDINATION CHEMISTRY; SALALEN COMPLEXES; LIGANDS SYNTHESIS; INDIUM COMPLEXES; SALEN LIGANDS; CYCLIC ESTERS; INITIATORS; CATALYSIS; ALUMINUMchemistry.chemical_classification010405 organic chemistryLigandCATALYSISCationic polymerizationNuclear magnetic resonance spectroscopyALUMINUM0104 chemical sciencesCrystallographychemistrySALEN LIGANDSAlkoxy groupINITIATORS[CHIM.OTHE]Chemical Sciences/OtherIsomerizationZIRCONIUM COMPLEXESDalton transactions (Cambridge, England : 2003)
researchProduct

Photochemically Produced Singlet Oxygen: Applications and Perspectives

2018

This Review aims to provide early stage researchers with an updated guide to applications of photochemically produced singlet oxygen and, at the same time, widen the experienced researcher's perspectives in a holistic approach to singlet oxygen chemistry. Without being exhaustive, literature between 2010 and early 2018 has been surveyed by focusing on a critical evaluation of new knowledge and applications. After an introductory section concerning singlet oxygen production, detection, and interactions with biological systems, subsequent sections describe current applications of singlet-oxygen-enabled technology. Besides strictly chemical synthesis applications, attention has been given to t…

010405 organic chemistryChemistryEnvironmental remediationSinglet oxygenmedicine.medical_treatmentOrganic ChemistryPhotodynamic therapySettore CHIM/06 - Chimica Organica010402 general chemistryPhotochemistry01 natural sciencessinglet oxygen0104 chemical sciencesAnalytical Chemistryphotooxygenation reactionchemistry.chemical_compoundphotodynamic therapymedicinePhysical and Theoretical Chemistryenvironmental remediationphototherapy
researchProduct

Green synthesis of cavity-containing manganese oxides with superior catalytic performance in toluene oxidation

2019

10 Figuras.- 2 Tablas.- Datos suplementarios disponibles en línea en la página web del editor.-- © 2019. This manuscript version is made available under the CC-BY-NC-ND 4.0 license http://creativecommons.org/licenses/by-nc-nd/4.0/

010405 organic chemistryChemistryStructural waterProcess Chemistry and TechnologyInorganic chemistryCationic polymerizationVOCs oxidationchemistry.chemical_elementNanoparticleManganeseCavities010402 general chemistry01 natural sciences7. Clean energyOxygenTolueneCatalysisHydrothermal circulationToluene oxidation0104 chemical sciencesCatalysischemistry.chemical_compoundManganese oxideToluene
researchProduct

Supramolecular chemistry of metalloporphyrins

2009

International audience

010405 organic chemistryChemistrySupramolecular chemistryreviewNanotechnologyGeneral Chemistry010402 general chemistryCrystal engineering01 natural sciencessupramolecular chemistry0104 chemical sciences[ CHIM.OTHE ] Chemical Sciences/Other[CHIM.OTHE]Chemical Sciences/OtherapplicationComputingMilieux_MISCELLANEOUSmetalloporphyrin
researchProduct

Functionalized phosphonates as building units for multi-dimensional homo- and heterometallic 3d-4f inorganic-organic hybrid-materials.

2016

Using the multifunctional ligand H4L (2,2'-bipyridinyl-5,5'-diphosphonic acid), a new family of inorganic-organic hybrid-materials was prepared. The ligand shows a very high flexibility regarding the coordination mode, leading to a large structural diversity. The compounds 1a, 1b ([M(H2L)(H2O)4]·2.5H2O; M = Co(2+) (a), Ni(2+) (b)), 2 ([Gd2(H2H'L)2(H2H'2L)(H2O)6]Cl4·14H2O), 3a, 3b, 3c ([MCo(iii)(H2L)3(H2O)2]·6.5H2O; M = Gd(3+) (a), Dy(3+) (b) and Tb(3+) (c)), and 4 ([GdNi(ii)(H2L)3(H2O)3]NaCl·6H2O) were isolated and characterized with single crystal X-ray diffraction. Depending on the used metal ions and on the stoichiometry, either discrete entities (0D), extended 2D layers or 3D frameworks…

010405 organic chemistryLigandStereochemistryMetal ions in aqueous solution010402 general chemistry01 natural sciencesPhosphonate0104 chemical sciencesInorganic Chemistrychemistry.chemical_compoundCrystallographychemistryMulti dimensionalHydrothermal synthesisHybrid materialSingle crystalStoichiometryDalton transactions (Cambridge, England : 2003)
researchProduct

Co–Co and Co–Fe cyano-bridged pentanuclear clusters based on a methylpyrazinyl-diamine tetradentate ligand: spin crossover and metal substitution eff…

2017

A pentanuclear [CoII3CoIII2] cluster complex has been developed by a solvothermal synthesis. Its highly stable metal-mixed Fe–Co derivatives display robust spin crossover (T1/2 = 268 K) controlled by the degree of substitution.

010405 organic chemistrySolvothermal synthesisSubstitution (logic)General Chemistry010402 general chemistryCondensed Matter PhysicsPhotochemistry01 natural sciences0104 chemical sciencesMetalCrystallographychemistry.chemical_compoundDegree of substitutionchemistrySpin crossovervisual_artDiaminevisual_art.visual_art_mediumCluster (physics)General Materials ScienceTetradentate ligandCrystEngComm
researchProduct