Search results for "pOR"

showing 10 items of 32221 documents

Evaluation of nano/submicro pores in suspension plasma sprayed YSZ coatings

2019

Abstract Nano-submicro pores could considerably influence the coating performances and thus should be properly designed for the intended applications. However, it is challenging to characterize accurately such small pores in coatings. In this study, YSZ coatings were firstly manufactured by suspension plasma spray (SPS) and the nano-submicro pores in as-prepared coatings were investigated using Ultra-small-angle X-ray scattering (USAXS). Afterwards, a multivariate analysis on the effect of five different process parameters was carried out. The two main results showed that: 1) the nano-submicro pores content in coatings has a negative correlation with suspension mass load and powder size, an…

010302 applied physicsMaterials scienceScatteringSintering02 engineering and technologySurfaces and InterfacesGeneral ChemistrySurface finishengineering.materialCondensed Matter Physics01 natural sciencesSurfaces Coatings and Films[SPI]Engineering Sciences [physics]020303 mechanical engineering & transports0203 mechanical engineeringCoating0103 physical sciencesNano-Materials ChemistryengineeringSuspension plasma sprayComposite materialSuspension (vehicle)Yttria-stabilized zirconiaSurface and Coatings Technology
researchProduct

Effect of oxidation post treatments on TiO2 coating manufactured using reactive very low-pressure plasma spraying (R-VLPPS)

2020

Abstract TiO2 coatings manufactured using reactive very low-pressure plasma spraying (R-VLPPS) were analyzed in different regions related to their position compared to the plasma flame. For that, a screen was used in order to hide an area of the substrate from the direct plasma flux. The coating morphology changed from quasi lamellar structure to highly vapor structure and coatings exhibited obvious modifications in terms of phases and mechanical properties. The effect of oxidation post treatment on the as sprayed coating was then studied by selecting two methods: in situ oxidation post treatment and classical thermal treatment. The two post treatments provided an increase of the main rutil…

010302 applied physicsMaterials scienceSubstrate (chemistry)02 engineering and technologySurfaces and InterfacesGeneral ChemistryPlasmaThermal treatmentengineering.material021001 nanoscience & nanotechnologyCondensed Matter Physics01 natural sciencesSurfaces Coatings and Films[SPI]Engineering Sciences [physics]CoatingRutilePhase (matter)0103 physical sciencesMaterials ChemistryengineeringLamellar structureComposite material0210 nano-technologyPorositySurface and Coatings Technology
researchProduct

2018

Damping distances of surface plasmon polariton modes sustained by different thin titanium nitride (TiN) films are measured at the telecom wavelength of 1.55 μm. The damping distances are correlated to the electrical direct current resistivity of the films sustaining the surface plasmon modes. It is found that TiN/Air surface plasmon mode damping distances drop non-linearly from 40 to 16μm as the resistivity of the layers increases from 28 to 130μΩ.cm, respectively. The relevance of the direct current (dc) electrical resistivity for the characterization of TiN plasmonic properties is investigated in the framework of the Drude model, on the basis of parameters extracted from spectroscopic ell…

010302 applied physicsMaterials sciencebusiness.industryDirect currentSurface plasmonPhysics::Opticschemistry.chemical_element02 engineering and technology021001 nanoscience & nanotechnology01 natural sciencesDrude modelSurface plasmon polaritonAtomic and Molecular Physics and OpticsCondensed Matter::Materials ScienceOpticschemistryElectrical resistivity and conductivityPhysical vapor deposition0103 physical sciencesOptoelectronics0210 nano-technologybusinessTinPlasmonOptics Express
researchProduct

Atomic Layer Deposition of Osmium

2011

Growth of osmium thin films and nanoparticles by atomic layer deposition is described. The Os thin films were successfully grown between 325 and 375 °C using osmocene and molecular oxygen as precursors. The films consisted of only Os metal as osmium oxides were not detected in X-ray diffraction measurements. Also the impurity contents of oxygen, carbon, and hydrogen were less than 1 at % each at all deposition temperatures. The long nucleation delay of the Os process facilitates either Os nanoparticle or thin film deposition. However, after the nucleation delay of about 350 cycles the film growth proceeded linearly with increasing number of deposition cycles. Also conformal growth of Os thi…

010302 applied physicsMaterials scienceta114General Chemical EngineeringInorganic chemistryAnalytical chemistryNucleationchemistry.chemical_element02 engineering and technologyGeneral ChemistryChemical vapor deposition021001 nanoscience & nanotechnologyOsmocene01 natural scienceschemistry.chemical_compoundAtomic layer depositionCarbon filmchemistry0103 physical sciencesMaterials ChemistryDeposition (phase transition)OsmiumThin film0210 nano-technologyta116Chemistry of Materials
researchProduct

Deep insight into electron transport and photovoltaic parameters in DSSCs

2019

Dye-sensitized solar cells (DSSCs) based on titanium (IV) oxide (TiO2) nanoparticles and nanotubes (NTs) with different weight ratios and phase compositions were fabricated. The obtained nanostructures were investigated using X-ray powder diffraction, scanning electron microscopy, transmission electron microscopy and ultraviolet–visible spectroscopy. Current–voltage measurements and electrochemical impedance spectroscopy were used to investigate the electron transport and photovoltaic performance of DSSCs. An increase of 14% in cell efficiency was achieved by introducing 10 wt% NTs. In this configuration, high dye loading is ensured and substantial improvement in electron transport efficie…

010302 applied physicsNanostructureMaterials sciencePhotovoltaic systemOxidechemistry.chemical_elementNanoparticle02 engineering and technology021001 nanoscience & nanotechnologyCondensed Matter Physics01 natural sciencesElectron transport chainchemistry.chemical_compoundchemistryChemical engineeringPhase (matter)0103 physical sciencesGeneral Materials Science0210 nano-technologyTitaniumEmerging Materials Research
researchProduct

Development, Characterization, and Testing of a SiC-Based Material for Flow Channel Inserts in High-Temperature DCLL Blankets

2018

This work has been carried out within the framework of the EUROfusion Consortium. The views and opinions expressed herein do not necessarily reflect those of the European Commission.

010302 applied physicsNuclear and High Energy PhysicsMaterials scienceFabricationelectrical conductivityBlanketCondensed Matter Physics01 natural sciencesTemperature measurement010305 fluids & plasmasCorrosionchemistry.chemical_compoundThermal conductivitydual-coolant lead-lithium (DCLL) blanketFlexural strengthchemistryCorrosion by PbLi0103 physical sciencesThermalSilicon carbide:NATURAL SCIENCES:Physics [Research Subject Categories]flow channel insert (FCI)thermal conductivityComposite materialporous SiCIEEE Transactions on Plasma Science
researchProduct

Radiation resistance of nanolayered silicon nitride capacitors

2020

Abstract Single-layered and multi-layered 20–60 nm thick silicon nitride (Si3N4) dielectric nanofilms were fabricated using a low-pressure chemical vapour deposition (LPCVD) method. The X-ray photoelectron spectroscopy (XPS) confirmed less oxygen content in the multi-layered nanofilms. The capacitors with Si3N4 multilayer demonstrated a tendency to a higher breakdown voltage compared to the capacitors with Si3N4 single layer. Si3N4 nanofilms and capacitors with Si3N4 dielectric were exposed to 1 kGy dose of gamma photons. Fourier transform infrared (FTIR) spectroscopy analysis showed that no modifications of the chemical bonds of Si3N4 were present after irradiation. Also, gamma irradiation…

010302 applied physicsNuclear and High Energy PhysicsMaterials sciencebusiness.industry02 engineering and technologyDielectricChemical vapor deposition021001 nanoscience & nanotechnology01 natural sciencesCapacitancelaw.inventionchemistry.chemical_compoundCapacitorSilicon nitridechemistrylaw0103 physical sciencesOptoelectronicsBreakdown voltageIrradiation0210 nano-technologybusinessInstrumentationRadiation resistanceNuclear Instruments and Methods in Physics Research Section B: Beam Interactions with Materials and Atoms
researchProduct

On the solution of a parabolic PDE involving a gas flow through a semi-infinite porous medium

2021

Abstract Taking as start point the parabolic partial differential equation with the respective initial and boundary conditions, the present research focuses onto the flow of a sample of waste-water derived from a standard/conventional dyeing process. In terms of a highly prioritized concern, meaning environment decontamination and protection, in order to remove the dyes from the waste waters, photocatalyses like ZnO or TiO2 nanoparticles were formulated, due to their high surface energy which makes them extremely reactive and attractive. According to the basics of ideal fluid, the key point is the gas flow through an ideal porous pipe consisting of nanoparticles bound one to each other, for…

010302 applied physicsPartial differential equationDifferential equationNumerical analysisGeneral Physics and Astronomy02 engineering and technologyMechanicsWastewater decontamination021001 nanoscience & nanotechnology01 natural sciencesParabolic partial differential equationlcsh:QC1-999Parabolic equation and systemsBoundary value problemsDifferential equationFlow (mathematics)0103 physical sciencesNanoporous ZnO particlesBoundary value problem0210 nano-technologyPorosityPorous mediumlcsh:PhysicsNumerical analysisResults in Physics
researchProduct

Positron Annihilation Lifetime Spectroscopy Insight on Free Volume Conversion of Nanostructured MgAl2O4 Ceramics

2021

H.K. and A.I.P. are grateful for the support from the COST Action CA17126. H.K. was also supported by the Ministry of Education and Science of Ukraine (project for young researchers No. 0119U100435). In addition, I.K. and H.K. were also supported by the National Research Foundation of Ukraine via project 2020.02/0217, while the research of A.I.P. was funded by the Latvian research council via the Latvian National Research Program under the topic ?High-Energy Physics and Accelerator Technologies?, Agreement No: VPP-IZM-CERN-2020/1-0002. In addition, the research of A.I.P. has been supported by the Latvian-Ukrainian Grant LV-UA/2021/5. The Institute of Solid State Physics, University of Latvi…

010302 applied physicsPositron trappingGeneral Chemical EngineeringFree-volume defectsPositron annihilationpositron annihilationnanoporespositronium decay02 engineering and technologynanostructured ceramicsfree-volume defectsnanostructured ceramics; positron annihilation; positronium decay; positron trapping; free-volume defects; nanopores021001 nanoscience & nanotechnologyPositronium decay7. Clean energy01 natural sciencesNanoporesChemistry0103 physical sciences:NATURAL SCIENCES [Research Subject Categories]positron trappingGeneral Materials Science0210 nano-technologyNanostructured ceramicsQD1-999Nanomaterials
researchProduct

Lead evaporation instabilities and failure mechanisms of the micro oven at the GTS-LHC ECR ion source at CERN

2020

The GTS-LHC ECR ion source (named after the Grenoble Test Source and the Large Hadron Collider) at CERN provides heavy ion beams for the chain of accelerators from Linac3 up to the LHC for high energy collision experiments and to the Super Proton Synchrotron for fixed target experiments. During the standard operation, the oven technique is used to evaporate lead into the source plasma to produce multiple charged lead ion beams. Intensity and stability are key parameters for the beam, and the operational experience is that some of the source instabilities can be linked to the oven performance. Over long operation periods of several weeks, the evaporation is not stable which makes the tuning …

010302 applied physicsRange (particle radiation)Large Hadron ColliderMaterials scienceionitNuclear engineeringEvaporationPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesSuper Proton SynchrotronIon source010305 fluids & plasmasIonComputer Science::OtherPhysics::Popular Physics0103 physical scienceslyijyInstrumentationBeam (structure)
researchProduct