Search results for "porat"

showing 10 items of 1595 documents

Towards the Improvement of Citizen Communication Through Computational Intelligence

2016

When dealing with problems that arise from collective sharing of resources in metropolitan areas (i.e., energy, pollution, traffic, health) most of the interaction between citizens and local governance is usually carried out through the use of natural languages. Digital technologies allows smart cities residents to communicate with a broad range of experts (e.g. bureaucrats, legislators, urbanists, etc.) that routinely use technical terminology seldom accessible to the layperson, or linguistic styles that are not immediately understandable. Although information technology should encourage citizen participation in governance at many levels, the different levels of knowledge possessed by the …

010302 applied physicsGovernmentKnowledge managementComputer sciencebusiness.industryCorporate governanceInformation technologyComputational intelligence010501 environmental sciences01 natural sciencesTerminologySmart city0103 physical sciencesComputational IntelligenceSocial exclusionbusinessNatural language0105 earth and related environmental sciences
researchProduct

Atomic Layer Deposition and Properties of Lanthanum Oxide and Lanthanum-Aluminum Oxide Films

2006

Atomic layer deposition (ALD) of lanthanum oxide on glass and silicon substrates was examined using lanthanum silylamide, La[N(SiMe 3 ) 2 ] 3 , and water as precursors in the substrate temperature range of 150-250 °C. The effect of pulse times and precursor evaporation temperature on the growth rate and refractive index was investigated. The films remained amorphous regardless of the deposition conditions. The resulting La 2 O 3 films contained noticeable amounts of hydrogen and silicon and were chemically unstable while stored in ambient air. Lanthanum aluminum oxide films were achieved with stoichiometry close to that of LaAlO 3 at 225°C from La[N(SiMe 3 ) 2 ] 3 , Al(CH 3 ) 3 , and H 2 O.…

010302 applied physicsLanthanideSiliconProcess Chemistry and TechnologyInorganic chemistrychemistry.chemical_element02 engineering and technologySurfaces and InterfacesGeneral ChemistrySubstrate (electronics)021001 nanoscience & nanotechnology01 natural sciencesEvaporation (deposition)Amorphous solidAtomic layer depositionchemistry.chemical_compoundchemistryLanthanum oxide0103 physical sciencesLanthanum0210 nano-technologyChemical Vapor Deposition
researchProduct

Lead evaporation instabilities and failure mechanisms of the micro oven at the GTS-LHC ECR ion source at CERN

2020

The GTS-LHC ECR ion source (named after the Grenoble Test Source and the Large Hadron Collider) at CERN provides heavy ion beams for the chain of accelerators from Linac3 up to the LHC for high energy collision experiments and to the Super Proton Synchrotron for fixed target experiments. During the standard operation, the oven technique is used to evaporate lead into the source plasma to produce multiple charged lead ion beams. Intensity and stability are key parameters for the beam, and the operational experience is that some of the source instabilities can be linked to the oven performance. Over long operation periods of several weeks, the evaporation is not stable which makes the tuning …

010302 applied physicsRange (particle radiation)Large Hadron ColliderMaterials scienceionitNuclear engineeringEvaporationPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesSuper Proton SynchrotronIon source010305 fluids & plasmasIonComputer Science::OtherPhysics::Popular Physics0103 physical scienceslyijyInstrumentationBeam (structure)
researchProduct

Comparison of gap-filling techniques applied to the CCI soil moisture database in Southern Europe

2021

Abstract Soil moisture (SM) is a key variable that plays an important role in land-atmosphere interactions. Monitoring SM is crucial for many applications and can help to determine the impact of climate change. Therefore, it is essential to have continuous and long-term databases for this variable. Satellite missions have contributed to this; however, the continuity of the series is compromised due to the data gaps derived by different factors, including revisit time, presence of seasonal ice or Radio Frequency Interference (RFI) contamination. In this work, the applicability of different gap-filling techniques is evaluated on the ESA Climate Change Initiative (CCI) SM combined product, whi…

010504 meteorology & atmospheric sciencesDatabaseCorrelation coefficient0208 environmental biotechnologySoil ScienceGeology02 engineering and technologycomputer.software_genre01 natural sciencesNormalized Difference Vegetation Index020801 environmental engineeringRandom forestSupport vector machineAutoregressive modelPrincipal component analysisPotential evaporationComputers in Earth Sciencescomputer0105 earth and related environmental sciencesMathematicsInterpolationRemote sensingRemote Sensing of Environment
researchProduct

Projecting Exposure to Extreme Climate Impact Events Across Six Event Categories and Three Spatial Scales

2020

Summarization: The extent and impact of climate‐related extreme events depend on the underlying meteorological, hydrological, or climatological drivers as well as on human factors such as land use or population density. Here we quantify the pure effect of historical and future climate change on the exposure of land and population to extreme climate impact events using an unprecedentedly large ensemble of harmonized climate impact simulations from the Inter‐Sectoral Impact Model Intercomparison Project phase 2b. Our results indicate that global warming has already more than doubled both the global land area and the global population annually exposed to all six categories of extreme events co…

010504 meteorology & atmospheric sciencesHYDROLOGICAL MODELSPopulation0207 environmental engineeringFLOOD RISKEnvironmental Sciences & Ecology02 engineering and technologySubtropics[SDU.STU.ME]Sciences of the Universe [physics]/Earth Sciences/Meteorology01 natural sciencesPopulation densityLatitudeClimate-related extreme events/dk/atira/pure/sustainabledevelopmentgoals/climate_actionEarth and Planetary Sciences (miscellaneous)SDG 13 - Climate ActionMeteorology & Atmospheric SciencesBURNED AREAGLOBAL CROP PRODUCTIONGeosciences Multidisciplinary020701 environmental engineeringeducation0105 earth and related environmental sciencesGeneral Environmental ScienceEvent (probability theory)education.field_of_studyScience & TechnologyLand useGlobal warmingGlobal warmingVEGETATION MODEL ORCHIDEEGeology15. Life on landTERRESTRIAL CARBON BALANCE13. Climate actionClimatologyPhysical SciencesTROPICAL CYCLONE ACTIVITYHURRICANE INTENSITYEnvironmental scienceTropical cycloneINTERANNUAL VARIABILITYLife Sciences & BiomedicineEnvironmental SciencesINCORPORATING SPITFIRE
researchProduct

Soil evaporation monitoring : a possible synergism of microwave and infrared remote sensing

1995

Abstract Microwave remote sensing allows the measurement of the water content (θs) at the soil surface within a layer of a few centimetres. When combined with climatic data, θs is a relevant quantity to estimate the evaporation of bare soils. The implementation of a simple daily evaporation (Ed) model on bare soils based on a knowledge of θs is analysed. In order to cover a wide range of soil, soil moisture and climatic conditions, the analysis was carried out on a set of data simulated by a mechanistic model of heat and water flows in the soil. Propagation error analysis on the inputs (θs, daily potential evaporation and wind velocity) of the simple model shows that an accuracy of ± 1.5 mm…

010504 meteorology & atmospheric sciencesMoisture[SDV]Life Sciences [q-bio]0207 environmental engineeringEvaporationSoil science02 engineering and technologySoil type01 natural sciencesPhysics::Geophysics[SDV] Life Sciences [q-bio]Soil waterPotential evaporationEnvironmental sciencePrecipitation020701 environmental engineeringWater contentPhysics::Atmospheric and Oceanic PhysicsMicrowaveComputingMilieux_MISCELLANEOUS0105 earth and related environmental sciencesWater Science and TechnologyRemote sensing
researchProduct

Social vulnerability to climate policies: Building a matrix to assess policy impacts on well-being

2021

In this article, we address the social vulnerability of people to climate mitigation policies and contribute to assessing the social impacts of climate policies by introducing a matrix tool for conducting vulnerability assessments and participatory climate policy planning. The matrix serves as a methodological tool for identifying social groups in their social spaces. First, we lay the foundation for the matrix by linking social vulnerability to equality and justice, demonstrating the importance of addressing social vulnerability in climate policy design and research. Next, we introduce the ways in which social vulnerability has been addressed in the integration of social and climate policy…

010504 meteorology & atmospheric sciencesvulnerabilityhyvinvointiGeography Planning and DevelopmentVulnerabilityContext (language use)010501 environmental sciencesManagement Monitoring Policy and Law01 natural sciencesEconomic JusticeSocial groupilmastopolitiikkawell-beingVulnerability assessmentPolitical scienceparticipationEnvironmental planninghaavoittuvuusosallistuminen0105 earth and related environmental sciencesevaluationCorporate governancesocial equalityWelfare stateoikeudenmukaisuussosiaalinen oikeudenmukaisuusjusticeeriarvoisuusarviointiSocial vulnerabilitysosiaaliset vaikutuksetEnvironmental Science & Policy
researchProduct

Evaporation from soils of different texture covered by layers of water repellent and wettable soils

2020

Water repellent soils are able to channel water deep into the soil profile by fingered flow, minimising water storage in the water repellent top layer where water is most susceptible to evaporation. To date, the effect of water repellent or wettable surface layer on evaporation from wet sublayer has only been reported for coarse materials, and an increase in water repellency led to a greater delay in water evaporation. The objective of this study was to assess the effect of water repellent vs. wettable top layers with different thickness on water evaporation from coarse and fine texture subsoils that were pre-moistened. Clay loam soil samples were taken from Pinus pinaster woodland of Ciavo…

0106 biological sciences0301 basic medicineSoil testSettore AGR/13 - Chimica AgrariaEvaporationEvaporationDuffSoil sciencePlant Science01 natural sciencesBiochemistry03 medical and health sciencesSoilGeneticsSettore AGR/08 - Idraulica Agraria E Sistemazioni Idraulico-ForestaliSurface layerMolecular BiologyEcology Evolution Behavior and SystematicsbiologyWater storageCell Biologybiology.organism_classificationPineWater repellency030104 developmental biologyLoamSoil waterEnvironmental sciencePinus pinasterSoil horizonAnimal Science and Zoology010606 plant biology & botany
researchProduct

Improved Extraction Efficiency of Antioxidant Bioactive Compounds from Tetraselmis chuii and Phaedoactylum tricornutum Using Pulsed Electric Fields

2020

Pulsed electric fields (PEF) is a promising technology that allows the selective extraction of high-added value compounds by electroporation. Thus, PEF provides numerous opportunities for the energy efficient isolation of valuable microalgal bioactive substances (i.e., pigments and polyphenols). The efficiency of PEF-assisted extraction combined with aqueous or dimethyl sulfoxide (DMSO) solvents in recovering pigments and polyphenols from microalgae Tetraselmis chuii (T. chuii) and Phaeodactylum tricornutum (P. tricornutum) was evaluated. Two PEF treatments were applied: (1 kV/cm/400 pulses, 3 kV/cm/45 pulses), with a specific energy input of 100 kJ/kg. The total antioxidant capacity (TAC) …

0106 biological sciencesChlorophyll bAntioxidantmedicine.medical_treatmentPharmaceutical ScienceTetraselmis chuii01 natural sciencesPhaeodactylum tricornutumArticleAntioxidantsAnalytical Chemistrylcsh:QD241-441chemistry.chemical_compound0404 agricultural biotechnologylcsh:Organic chemistryChlorophyta010608 biotechnologyDrug DiscoverymedicineMicroalgaePhaeodactylum tricornutum<i>Phaeodactylum tricornutum</i>Physical and Theoretical ChemistryTetraselmis<i>Tetraselmis chuii</i>Carotenoidchemistry.chemical_classificationDiatomsChromatographybiologyChemistryDimethyl sulfoxideOrganic ChemistryExtraction (chemistry)Polyphenols04 agricultural and veterinary sciencesbiology.organism_classification040401 food science6. Clean waterElectroporationpulsed electric fieldsChemistry (miscellaneous)PolyphenolextractionMolecular Medicineantioxidant bioactive compoundsMolecules
researchProduct

Enabling policy innovations promoting multiple ecosystem benefits: lessons learnt from case studies in the Baltic Sea Region

2019

Abstract This paper analyses how specific institutional barriers and drivers affect the success of agri-environmental governance and policy innovations in four case study catchments in Germany, Latvia, Poland and Sweden. Possible adaptations of institutional settings are explored, aiming at increased effectiveness of policies and governance in delivering multiple ecosystem benefits along with reduced nutrient emissions and flood management. Factors of success synthesized from existing examples of innovative policy instruments in the EU and further afield are used to identify barriers and opportunities for the implementation of policy innovations in different institutional settings across th…

0106 biological sciencesCivil societyFlood mythCorporate governanceGeography Planning and Development0211 other engineering and technologiesStakeholder021107 urban & regional planningCitizen journalism02 engineering and technologyManagement Monitoring Policy and LawPrivate sector01 natural sciences010601 ecologyIntermediaryIncentiveBusinessEnvironmental planningWater Science and TechnologyWater Policy
researchProduct