Search results for "sheath"

showing 10 items of 112 documents

A study of the optical effect of plasma sheath in a negative ion source using IBSIMU code

2020

A plasma sheath inside an ion source has a strong focusing effect on the formation of an ion beam from the plasma. Properties of the beam depend on the shape and location of the plasma sheath inside the source. The most accessible experimental data dependent on the plasma sheath are the beam phase space distribution. Variation of beam emittance is a reflection of the properties of the plasma sheath, with minimum emittance for the optimal shape of the plasma sheath. The location and shape of the plasma sheath are governed by complex physics and can be understood by simulations using plasma models in particle tracking codes like IBSimu. In the current study, a model of the D-Pace’s TRIUMF lic…

010302 applied physicsDebye sheathMaterials scienceIon beamPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesIon sourcenegative ion source010305 fluids & plasmassymbols.namesakeplasma sheathPhysics::Plasma Physics0103 physical sciencesPhysics::Space PhysicssymbolsPhysics::Accelerator PhysicsThermal emittanceStrong focusingBeam emittanceAtomic physicsInstrumentationBeam (structure)
researchProduct

Deviation of H− beam extraction simulation model

2018

Negative hydrogen ion source extraction system development is dependent on accurate and fast simulation methods for modelling the behaviour of ion and electron beams. Traditionally this type of work has been done using ray-tracing extraction codes, such as IBSimu. The plasma extraction model in IBSimu has been observed to under-estimate the charge density near the plasma sheath, leading to incorrect prediction of the current at which the system produces the optimum emittance. It is suspected that this deviation results from the approximations made by the model, neglecting the magnetic field and collisional effects near the sheath region. Results and comparisons to simulations are presented …

010302 applied physicsMaterials scienceta114business.industryExtraction (chemistry)tietokonegrafiikkaplasmafysiikka01 natural sciencesOpticsion sourcesPhysics::Plasma Physicscomputer graphics0103 physical sciencessimulointi010306 general physicsbusinessBeam (structure)plasma sheaths
researchProduct

Time resolved measurements of hydrogen ion energy distributions in a pulsed 2.45 GHz microwave plasma

2017

A plasma diagnostic study of the Ion Energy Distribution Functions (IEDFs) of H+, H+2H2+, and H+3H3+ ions in a 2.45 GHz hydrogen plasma reactor called TIPS is presented. The measurements are conducted by using a Plasma Ion Mass Spectrometer with an energy sector and a quadrupole detector from HIDEN Analytical Limited in order to select an ion species and to measure its energy distribution. The reactor is operated in the pulsed mode at 100 Hz with a duty cycle of 10% (1 ms pulse width). The IEDFs of H+, H+2H2+, and H+3H3+ are obtained each 5 μs with 1 μs time resolution throughout the entire pulse. The temporal evolution of the plasma potential and ion temperature of H+ is derived from the d…

010302 applied physicsPhysicsRange (particle radiation)plasma sourcesta114plasma diagnosticsPlasmaCondensed Matter PhysicsMass spectrometry01 natural sciences7. Clean energyIon source010305 fluids & plasmasIonplasma dynamicsPhysics::Plasma Physics0103 physical sciencesThermal emittancePlasma diagnosticsionAtomic physicsMicrowaveplasma sheathsPhysics of Plasmas
researchProduct

Functions of histone modifications and histone modifiers in Schwann cells.

2019

Schwann cells (SCs) are the main glial cells present in the peripheral nervous system (PNS). Their primary functions are to insulate peripheral axons to protect them from the environment and to enable fast conduction of electric signals along big caliber axons by enwrapping them in a thick myelin sheath rich in lipids. In addition, SCs have the peculiar ability to foster axonal regrowth after a lesion by demyelinating and converting into repair cells that secrete neurotrophic factors and guide axons back to their former target to finally remyelinate regenerated axons. The different steps of SC development and their role in the maintenance of PNS integrity and regeneration after lesion are c…

0301 basic medicine570 Life sciencesLesionHistones03 medical and health sciencesCellular and Molecular Neuroscience0302 clinical medicineNeurotrophic factorsPeripheral Nerve InjuriesmedicineAnimalsHumansSecretionTranscription factorMyelin SheathbiologyRegeneration (biology)AxonsCell biologyNerve Regeneration030104 developmental biologyHistonemedicine.anatomical_structurenervous systemNeurologyMyelin sheathPeripheral nervous systembiology.proteinSchwann Cellsmedicine.symptom030217 neurology & neurosurgery570 BiowissenschaftenGliaREFERENCES
researchProduct

Adult rat myelin enhances axonal outgrowth from neural stem cells.

2018

Axon regeneration after spinal cord injury (SCI) is attenuated by growth inhibitory molecules associated with myelin. We report that rat myelin stimulated the growth of axons emerging from rat neural progenitor cells (NPCs) transplanted into sites of SCI in adult rat recipients. When plated on a myelin substrate, neurite outgrowth from rat NPCs and from human induced pluripotent stem cell (iPSC)-derived neural stem cells (NSCs) was enhanced threefold. In vivo, rat NPCs and human iPSC-derived NSCs extended greater numbers of axons through adult central nervous system white matter than through gray matter and preferentially associated with rat host myelin. Mechanistic investigations excluded …

0301 basic medicineAgingNeuronalNudeMessengerNeurodegenerativeInbred C57BLRegenerative MedicineMedical and Health SciencesMyelinMiceNeural Stem CellsStem Cell Research - Nonembryonic - HumanCyclic AMPAxonPhosphorylationGray MatterInduced pluripotent stem cellExtracellular Signal-Regulated MAP KinasesSpinal Cord InjuryMyelin SheathInbred F344Neuronal growth regulator 1Stem Cell Research - Induced Pluripotent Stem Cell - HumanChemistryGeneral MedicineBiological SciencesWhite MatterNeural stem cellCell biologymedicine.anatomical_structureSpinal Cord5.1 PharmaceuticalsNeurologicalFemaleStem Cell Research - Nonembryonic - Non-HumanDevelopment of treatments and therapeutic interventionsPhysical Injury - Accidents and Adverse EffectsNeuriteCell Adhesion Molecules NeuronalCentral nervous systemNeuronal OutgrowthArticleWhite matter03 medical and health sciencesRats NudemedicineAnimalsHumansRNA MessengerStem Cell Research - Embryonic - HumanTraumatic Head and Spine InjuryTransplantationStem Cell Research - Induced Pluripotent Stem CellNeurosciencesStem Cell ResearchRats Inbred F344AxonsRatsMice Inbred C57BL030104 developmental biologynervous systemChondroitin Sulfate ProteoglycansRNACell Adhesion Molecules
researchProduct

A novel microglial subset plays a key role in myelinogenesis in developing brain.

2017

Microglia are resident macrophages of the central nervous system that contribute to homeostasis and neuroinflammation. Although known to play an important role in brain development, their exact function has not been fully described. Here, we show that in contrast to healthy adult and inflammation-activated cells, neonatal microglia show a unique myelinogenic and neurogenic phenotype. A CD11c(+) microglial subset that predominates in primary myelinating areas of the developing brain expresses genes for neuronal and glial survival, migration, and differentiation. These cells are the major source of insulin-like growth factor 1, and its selective depletion from CD11c(+) microglia leads to impa…

0301 basic medicineAgingmedicine.medical_treatmentNews & ViewsInsulin-Like Growth Factor IMyelin SheathCell AggregationNeural PlateMicrogliaACTIVATED MICROGLIAGeneral NeuroscienceExperimental autoimmune encephalomyelitisNeurogenesisIGF1BrainGene Expression Regulation DevelopmentalADULT BRAINUp-RegulationALZHEIMERS-DISEASEmedicine.anatomical_structureEXPERIMENTAL AUTOIMMUNE ENCEPHALOMYELITISMyelinogenesisGROWTHFemaleMicrogliaCNSEncephalomyelitis Autoimmune ExperimentalNeurogenesisCentral nervous systemCD11cBiologyGeneral Biochemistry Genetics and Molecular BiologyDEPENDENT MANNER03 medical and health sciencesmedicinePOSTNATAL-DEVELOPMENTAnimalsMolecular BiologyNeuroinflammationGeneral Immunology and MicrobiologyCD11cGrowth factorGene Expression ProfilingCENTRAL-NERVOUS-SYSTEMmedicine.diseaseGALECTIN-1CD11c AntigenMice Inbred C57BL030104 developmental biologynervous systemAnimals NewbornImmunologymyelinogenesisNeuroscienceBiomarkersThe EMBO journal
researchProduct

Extracellular vesicles in the oligodendrocyte microenvironment

2019

Abstract Extracellular vesicles (EVs) recently took centre stage as mediators of cellular crosstalk modulating the tissue microenvironment. Released by all types of neural cells, EVs may execute a broad spectrum of functions ranging from maintenance of neuronal homeostasis and regulation of neural plasticity to the spread of neurodegenerative agents. Myelinating oligodendrocytes and axons form a highly specialized functional entity that depends on intimate interactions within the oligodendrocyte-neuron niche. EVs released by oligodendrocytes are internalized by neurons in response to neuronal signals and exhibit neuroprotective properties but also may influence other cells present in the mi…

0301 basic medicineBiologyNerve Fibers MyelinatedExtracellular vesiclesNeuroprotectionExtracellular Vesicles03 medical and health sciences0302 clinical medicineNeuroplasticitymedicineAnimalsHumansMyelin SheathTissue homeostasisGeneral NeuroscienceOligodendrocyteMicrovesiclesCell biologyOligodendrogliaCrosstalk (biology)030104 developmental biologymedicine.anatomical_structureCellular Microenvironmentnervous system030217 neurology & neurosurgeryHomeostasisSignal TransductionNeuroscience Letters
researchProduct

Taking Advantage of Nature’s Gift: Can Endogenous Neural Stem Cells Improve Myelin Regeneration?

2016

Irreversible functional deficits in multiple sclerosis (MS) are directly correlated to axonal damage and loss. Neurodegeneration results from immune-mediated destruction of myelin sheaths and subsequent axonal demyelination. Importantly, oligodendrocytes, the myelinating glial cells of the central nervous system, can be replaced to some extent to generate new myelin sheaths. This endogenous regeneration capacity has so far mainly been attributed to the activation and recruitment of resident oligodendroglial precursor cells. As this self-repair process is limited and increasingly fails while MS progresses, much interest has evolved regarding the development of remyelination-promoting strateg…

0301 basic medicineCell typeMultiple Sclerosisgliaadult neural stem cellsoligodendrocytesReviewBiologyRegenerative MedicineCatalysisInorganic ChemistryWhite matterlcsh:Chemistry03 medical and health sciencesMyelin0302 clinical medicineNeural Stem CellsmedicineAnimalsHumansPhysical and Theoretical ChemistryRemyelinationMolecular Biologylcsh:QH301-705.5SpectroscopyMyelin SheathMultiple sclerosisRegeneration (biology)Organic ChemistryEndogenous regenerationGeneral Medicinedifferentiationmedicine.diseaseNeural stem cellComputer Science ApplicationsNerve Regeneration030104 developmental biologymedicine.anatomical_structureremyelinationlcsh:Biology (General)lcsh:QD1-999nervous systemprecursor cellsImmunologyNeurosciencecell fate determinationwhite matter030217 neurology & neurosurgeryInternational Journal of Molecular Sciences
researchProduct

The transcriptome of mouse central nervous system myelin

2016

AbstractRapid nerve conduction in the CNS is facilitated by insulation of axons with myelin, a specialized oligodendroglial compartment distant from the cell body. Myelin is turned over and adapted throughout life; however, the molecular and cellular basis of myelin dynamics remains elusive. Here we performed a comprehensive transcriptome analysis (RNA-seq) of myelin biochemically purified from mouse brains at various ages and find a surprisingly large pool of transcripts enriched in myelin. Further computational analysis showed that the myelin transcriptome is closely related to the myelin proteome but clearly distinct from the transcriptomes of oligodendrocytes and brain tissues, suggesti…

0301 basic medicineCentral Nervous SystemMaleProteolipid protein 1CellCentral nervous systemBiologyArticleTranscriptome03 medical and health sciencesMyelin0302 clinical medicinemedicineCompartment (development)AnimalsComputational analysisRNA MessengerMyelin SheathPrincipal Component AnalysisMultidisciplinaryGene Expression Regulation DevelopmentalCell biologyMice Inbred C57BL030104 developmental biologymedicine.anatomical_structurenervous systemProteomeImmunologyTranscriptome030217 neurology & neurosurgeryBiomarkers
researchProduct

Oligodendrocytes control potassium accumulation in white matter and seizure susceptibility

2018

Oligodendrocytes Control Potassium Accumulation in White Matter and Seizure Susceptibility.Larson VA, Mironova Y, Vanderpool KG, Waisman A, Rash JE, Agarwal A, Bergles DE. Elife. 2018 Mar 29;7. pii: e34829. doi: 10.7554/eLife.34829.The inwardly rectifying K+ channel Kir4.1 is broadly expressed by central nervous system glia and deficits in Kir4.1 lead to seizures and myelin vacuolization. However, the role of oligodendrocyte Kir4.1 channels in controlling myelination and K+ clearance in white matter has not been defined. Here, we show that selective deletion of Kir4.1 from oligodendrocyte progenitors or mature oligodendrocytes did not impair their development or disrupt the structure of mye…

0301 basic medicineKir4.1QH301-705.5seizureScienceMice TransgenicGeneral Biochemistry Genetics and Molecular BiologyWhite matterMice03 medical and health sciencesEpilepsyMyelin0302 clinical medicineSeizuresmedicineExtracellularAnimalsHomeostasisBiology (General)Potassium Channels Inwardly RectifyingProgenitor cellMyelin SheathMice KnockoutGeneral Immunology and MicrobiologyChemistryGeneral NeuroscienceQRGeneral Medicinemedicine.diseaseWhite MatterCurrent Literature in Basic ScienceOligodendrocyteCell biologymyelinOligodendroglia030104 developmental biologymedicine.anatomical_structureVacuolizationPotassiumepilepsyMedicineoligodendrocyteGene Deletion030217 neurology & neurosurgeryHomeostasiseLife
researchProduct