Search results for "solu"

showing 10 items of 7577 documents

Esriinin merkitys syövässä

2014

Tutkimukseni selvittää esriinin tehtäviä ja säätelyä erityisesti syövän kannalta. Esriini kuuluu ERM-proteiiniperheeseen (esriini/radiksiini/moesiini). Nämä proteiinit tarttuvat toisaalta solun aktiinitukirankaan, toisaalta solukalvon reseptoreihin. Esriini vaikuttaa solutukirangan järjestäytymiseen ja solun kortikaalisiin muodonmuutoksiin. Voimistunut esriinin ekspressio korreloi tiettyjen syöpätyyppien maligniteettiin ja erityisesti metastointikykyyn. Esriinin tiedetään esimerkiksi olevan välttämätön osteosarkooman metastaasissa. Tutkimuksen tavoitteena oli selvittää Src-kinaasin katalysoiman fosforyloinnin merkitystä esriinin toiminnalle syöpään liittyvissä ilmiöissä, esim. invaasiossa j…

kasvaimetsyöpäsolutfosforylaatiosyöpätauditesriinietäpesäkkeet
researchProduct

Development of DNA aptamers for visualization of glial brain tumors and detection of circulating tumor cells

2023

Here, we present DNA aptamers capable of specific binding to glial tumor cells in vitro, ex vivo, and in vivo for visualization diagnostics of central nervous system tumors. We selected the aptamers binding specifically to the postoperative human glial primary tumors and not to the healthy brain cells and meningioma, using a modified process of systematic evolution of ligands by exponential enrichment to cells; sequenced and analyzed ssDNA pools using bioinformatic tools and identified the best aptamers by their binding abilities; determined three-dimensional structures of lead aptamers (Gli-55 and Gli-233) with small-angle X-ray scattering and molecular modeling; isolated and identified mo…

kasvaimetsyöpäsolutvisualisointiDrug DiscoveryMolecular MedicineOriginal ArticlemerkkiaineetDNAMolecular Therapy - Nucleic Acids
researchProduct

From isolated 1H-pyrazole cryptand anion receptors to hybrid inorganic-organic 1D helical polymeric anion receptors

2015

We report a novel 1-D helical coordination polymer formed by protonated polyamine 1H-pyrazole cryptands interconnected by Cu2+ metal ions that are able to encapsulate anionic species behaving as a multianion receptor. Switching from a monomeric receptor to a polymeric receptor is activated by metal ions and pH.

kemiaChemistryStereochemistryCoordination polymerMetal ions in aqueous solutionCryptandreceptorsProtonationPyrazolechemistryInorganic Chemistrychemistry.chemical_compoundMonomerPolymer chemistryPolyamineReceptorta116Dalton Transactions 44: 7761-7764 (2015)
researchProduct

Rapid self-healing and anion selectivity in metallosupramolecular gels assisted by fluorine-fluorine interactions.

2017

Simple ML2 [M = Fe(II), Co(II), Ni(II)] complexes obtained from a perfluoroalkylamide derivative of 4-aminophenyl-2,2′,6,2′-terpyridine spontaneously, yet anion selectively, self-assemble into gels, which manifest an unprecedented rapid gel strength recovery, viz. self-healing, and thermal rearrangement in aqueous dimethyl sulfoxide. The key factor for gelation and rheological properties emerges from the fluorine–fluorine interactions between the perfluorinated chains, as the corresponding hydrocarbon derivative did not form metallogels. The perfluoro-terpyridine ligand alone formed single crystals, while its Fe(II), Co(II) or Ni(II) complexes underwent rapid gelation leading to highly enta…

kemiachemistry.chemical_element02 engineering and technology010402 general chemistrychemistry01 natural sciencesMetalInorganic Chemistrychemistry.chemical_compoundTheoretical and Computational ChemistryfluorinePolymer chemistryOrganic chemistryThermal stabilitymoleculeshydrocarbonsta116chemistry.chemical_classificationgeelitAqueous solutionta114Ligandmolekyylit021001 nanoscience & nanotechnologygelsfluorihiilivedyt0104 chemical sciencesHydrocarbonchemistryvisual_artFluorinevisual_art.visual_art_mediumInorganic & Nuclear Chemistry0210 nano-technologySelectivityOther Chemical SciencesDerivative (chemistry)
researchProduct

Synthesis, Characterization, and Cytotoxicity of New Spirooxindoles Engrafted Furan Structural Motif as a Potential Anticancer Agent

2022

A new series of spirooxindoles based on ethylene derivatives having furan aryl moiety are reported. The new hybrids were achieved via [3 + 2] cycloaddition reaction as an economic one-step efficient approach. The final constructed spirooxindoles have four contiguous asymmetric carbon centers. The structure of 3a is exclusively confirmed using X-ray single crystal diffraction. The supramolecular structure of 3a is controlled by O···H, H···H, and C···C intermolecular contacts. It includes layered molecules interconnected weak C–H···O (2.675 Å), H···H (2.269 Å), and relatively short Cl···Br interhalogen interactions [3.4500(11)Å]. Using Hirshfeld analysis, the percentages of these intermolecul…

kemiallinen synteesisyöpäsolutbioaktiiviset yhdisteetGeneral Chemical EngineeringspirooxindolesGeneral ChemistryHirshfeld analysisheterosykliset yhdisteet
researchProduct

Halloysite Nanotubes Coated by Chitosan for the Controlled Release of Khellin

2020

In this work, we have developed a novel strategy to prepare hybrid nanostructures with controlled release properties towards khellin by exploiting the electrostatic interactions between chitosan and halloysite nanotubes (HNT). Firstly, khellin was loaded into the HNT lumen by the vacuum-assisted procedure. The drug confinement within the halloysite cavity has been proved by water contact angle experiments on the HNT/khellin tablets. Therefore, the loaded nanotubes were coated with chitosan as a consequence of the attractions between the cationic biopolymer and the halloysite outer surface, which is negatively charged in a wide pH range. The effect of the ionic strength of the aqueous medium…

khellinAqueous solutionMaterials scienceKhellinPolymers and Plasticsrelease propertieshalloysite nanotubesthermogravimetryGeneral Chemistryengineering.materialHalloysiteControlled releaseArticleNanomaterialslcsh:QD241-441ChitosanContact anglechemistry.chemical_compoundlcsh:Organic chemistrychemistryChemical engineeringengineeringSurface chargechitosanPolymers
researchProduct

Digitarinoita : mitä on koulutusteknologiapuhe ja miksi siihen tulee suhtautua epäillen

2022

Teknologialla on teknisen olemuksensa lisäksi myös kielellinen ulottuvuus, mutta näiden kahden välillä ei välttämättä vallitse juuri minkäänlaista vastaavuussuhdetta. Tästä syystä on tärkeää kyetä erottamaan teknologian realistiset mahdollisuudet koulutusteknologiapuheen maalaamista fantasioista. Tämä artikkeli auttaa lukijaa koulutusteknologiapuheen tunnistamisessa ja kriittisessä tarkastelussa esittelemällä sen kolme tyypillistä olomuotoa; tekno-optimismin, teknosolutionismin ja teknodeterminismin. nonPeerReviewed

kieli ja kieletkoulutusteknologiadiskurssiteknologiatekno-optimismiopetusteknologiakoulutusteknologiapuheteknodeterminismidiskurssintutkimusteknosolutionismi
researchProduct

Kiintymystyylit, kiintymyksen turvallisuus, koettu sosiaalinen tuki ja tunneilmaisun ristiriita keskiaikuisuudessa : pitkittäistutkimuksellinen näkök…

2011

Aikuisuuden kiintymystyylit heijastavat yksilön tapaa ajatella, tuntea ja käyttäytyä läheisissä ihmissuhteissa. Tässä tutkimuksessa tarkasteltiin, millaista kiintymystyylien (turvallinen, itseriittoinen, takertuva ja pelokas) suhteellinen ja absoluuttinen pysyvyys on keskiaikuisuudessa. Kiintymystyylien suhteellista pysyvyyttä tutkittiin Spearmanin korrelaatiokertoimella, ja absoluuttista pysyvyyttä tarkasteltiin Wilcoxonin testillä. Lisäksi yksitekijäisen toistettujen mittausten varianssinanalyysin avulla tarkasteltiin kiintymyksen turvallisuuden yhteyksiä koettuun sosiaalisen tukeen ja tunneilmaisun ristiriitaan. Tutkimuksessa käytettiin Lea Pulkkisen vuonna 1968 aloittaman Lapsesta aikui…

kiintymystyylitkiintymyspysyvyyssuhteellinen pysyvyysaikuisuuskoettu sosiaalinen tukiturvallisuussosiaalinen tukikiintymyksen turvallisuuspitkittäistutkimuskeskiaikuisuustunneilmaisun ristiriitaabsoluuttinen pysyvyys
researchProduct

Otrējo spirtu dinamiskā kinētiskā sadalīšana

2019

Antrinių alkoholių dinaminė kinetinė rezoliucija. Simonas Balkaitis. Darbo vadovas: Dr. chem. Artis Kinēns. Magistrinį darbą sudaro 63 puslapiai, 10 iliustracijų, 31 schema, 14 lentelių, 1 lygtis, 53 literatūros šaltiniai. Darbas parašytas anglų kalba. Pirmiausia buvo ištirta antrinių alkoholių racemizacija įvairių iridžio, rutenio ir geležies katalizatorių pagalba. Tuomet, racemizacijai tinkamiausiuose tirpiklių variantuose buvo tiriama alkoholių kinetinė rezoliucija. Gauti duomenys buvo panaudoti naujos dinaminės kinetinės rezoliucijos procedūros paieškose.

kinetic resolutioniridiumrutheniumracemisationĶīmijaDynamic kinetic resolution
researchProduct

Rats bred for low intrinsic aerobic exercise capacity link obesity with brain inflammation and reduced structural plasticity of the hippocampus.

2021

Abstract BACKGROUND Increasing evidence shows obesity and poor metabolic health are associated with cognitive deficits, but the mechanistic connections have yet to be resolved. We studied rats selectively bred for low and high intrinsic aerobic capacity in order to test the association between low physical fitness, a genetic predisposition for obesity, and brain health. We hypothesized that low-capacity runner (LCR) rats with concurrently greater levels of adiposity would have increased hippocampal inflammation and reduced plasticity compared to the more physically fit high-capacity runner (HCR) rats. METHODS We examined markers for inflammation and brain plasticity in the hippocampi of LCR…

kognitioPhysical fitnessbiomarkkeritHippocampal formationHippocampusBehavioral Neuroscience0302 clinical medicineHippocampus (mythology)aineenvaihduntaAdiposity2. Zero hunger0303 health sciencesExercise TolerancetulehdusNeurogenesisylipainoneurogenesisfyysinen kuntoEncephalitisgeneettiset tekijätmedicine.symptomaivotkognitiiviset taidotmedicine.medical_specialtyneuroplasticityImmunologyInflammationperinnöllinen alttius03 medical and health sciencesInternal medicinePhysical Conditioning AnimalNeuroplasticitymedicineGenetic predispositionAerobic exerciseAnimalshippokampusObesityneuroplastisuus030304 developmental biologyEndocrine and Autonomic Systemsbusiness.industrysytokiinitsynaptic proteinscytokinesRatshermosolutEndocrinologylihavuusproteiinitbusinesshuman activities030217 neurology & neurosurgeryBrain, behavior, and immunity
researchProduct