0000000000002441

AUTHOR

Moritz Schumann

showing 34 related works from this author

Fitness and lean mass increases during combined training independent of loading order.

2014

Although the benefits of combined endurance (E) and strength (S) training for the development of physical fitness and health are well known, scientific examination of the effect of loading order when E and S are combined into the same training session (E+S vs S+E) is rare. This study investigated the effects of moderate frequency E+S versus S+E training on physical fitness, body composition, and blood lipids.Physically active and healthy young men performed E+S (n = 16) or S+E (n = 18) training 2-3 times a week for 24 wk. Endurance (by incremental bike test) and strength (by dynamic leg press) performance as well as body composition (by dual-energy x-ray absorptiometry), muscle cross-sectio…

AdultMalemedicine.medical_specialtyOrder effecteducationPhysical fitnessPhysical Therapy Sports Therapy and RehabilitationTriglycerides bloodQuadriceps MuscleYoung AdultAbsorptiometry PhotonThinnessmedicineAerobic exerciseHumansOrthopedics and Sports MedicineMuscle Strengthta315TriglycerideskehonkoostumusMathematicsAdiposityUltrasonographybusiness.industryCholesterol HDLTraining (meteorology)Resistance TrainingHuman physiologyCholesterol LDLmuscle cross-sectional areaaerobinen harjoitteluDiet Recordsconcurrent endurance and strength trainingPhysical FitnessLean body massPhysical therapyBody CompositionExercise TestPhysical Enduranceorder effectresistance trainingUltrasonographyhypertrophybusinessEnergy IntaketerveysPhysical Conditioning HumanMedicine and science in sports and exercise
researchProduct

Acute Endocrine and Force Responses and Long-Term Adaptations to Same-Session Combined Strength and Endurance Training in Women

2015

This study examined acute hormone and force responses and strength and endurance performance and muscle hypertrophy before and after 24 weeks of same-session combined strength and endurance training in previously untrained women. Subjects were assigned 1 of 2 training orders: endurance preceding strength (E + S, n = 15) or vice versa (S + E, n = 14). Acute force and hormone responses to a combined loading (continuous cycling and a leg press protocol in the assigned order) were measured. Additionally, leg press 1 repetition maximum (1RM), maximal workload during cycling (Wmax), and muscle cross-sectional area (CSA) were assessed. Loading-induced decreases in force were significant (p < 0.01–…

Adultmedicine.medical_specialtyAdolescentRepetition maximumPhysical Therapy Sports Therapy and RehabilitationGrowth hormoneQuadriceps MuscleMuscle hypertrophyYoung Adult03 medical and health sciences0302 clinical medicineEndurance trainingInternal medicinemedicineHumansEndocrine systemConcurrent trainingTestosteroneOrthopedics and Sports MedicineMuscle StrengthExercise physiologyta315Leg pressExerciseGrowth hormonePerformance adaptationsTestosteroneUltrasonographyHuman Growth Hormonebusiness.industry030229 sport sciencesGeneral MedicineOrder effectAdaptation PhysiologicalEndocrinologyPhysical EnduranceFemaletestosteronibusiness030217 neurology & neurosurgeryPhysical Conditioning HumanJournal of Strength and Conditioning Research
researchProduct

Maximal isometric strength indices are associated with the oxygen cost of walking and running in recreationally active men and women.

2021

This study assessed the associations of maximal isometric strength and movement economy in 126 recreationally active men and women. Oxygen consumption was assessed through a graded treadmill test with 4-minute increments (4-12 km∙h

Malemedicine.medical_specialtyHand Strengthbusiness.industrychemistry.chemical_elementPhysical Therapy Sports Therapy and RehabilitationIsometric exerciseWalkingOxygenRunningOxygenPhysical medicine and rehabilitationOxygen ConsumptionchemistryMaximal strengthMedicineHumansOrthopedics and Sports MedicineFemaleMuscle StrengthTreadmillbusinessMuscle SkeletalResearch in sports medicine (Print)
researchProduct

Recommendations for Determining the Validity of Consumer Wearables and Smartphones for the Estimation of Energy Expenditure : Expert Statement and Ch…

2022

Open Access funding provided by the IReL Consortium. This research was partly funded by Huawei Technologies, Finland. RA and BC are partly funded by Science Foundation Ireland (12/RC/2289_P2). PMG and FBO are supported by grants from the MINECO/FEDER (DEP2016-79512-R) and from the University of Granada, Plan Propio de Investigacion 2016, Excellence actions: Units of Excellence; Scientific Excellence Unit on Exercise and Health (UCEES); Junta de Andalucia, Consejeria de Conocimiento, Investigacion y Universidades and European Regional Development Funds (ref. SOMM17/6107/UGR). JT and JS are partly funded by the Research Council of Norway (249932/F20). AG is supported by a European Research Co…

mittaustekniikkahyvinvointiteknologiavaliditeettiPhysical Therapy Sports Therapy and RehabilitationOrthopedics and Sports Medicinepuettava teknologiafyysinen aktiivisuusenergiankulutus (aineenvaihdunta)systemaattiset kirjallisuuskatsauksetälypuhelimet
researchProduct

Effect of Chronic Exercise Training on Blood Lactate Metabolism Among Patients With Type 2 Diabetes Mellitus : A Systematic Review and Meta-Analysis

2021

Purpose: To assess the effect of chronic exercise training on blood lactate metabolism at rest (i.e., basal lactate concentrations) and during exercise (i.e., blood lactate concentration at a fixed load, load at a fixed blood lactate concentration, and load at the individual blood lactate threshold) among patients with type 2 diabetes mellitus (T2DM).Methods: PubMed (MedLine), Embase, Web of Science, and Scopus were searched. Randomized controlled trials, non-randomized controlled trials, and case-control studies using chronic exercise training (i.e., 4 weeks) and that assessed blood lactate concentrations at rest and during exercise in T2DM patients were included.Results: Thirteen studies …

medicine.medical_specialtySports medicinePhysiologyT2DMbiomarkkerithyperlactatemialcsh:Physiologylaw.inventionchemistry.chemical_compoundphysical trainingaineenvaihduntahäiriötRandomized controlled triallawPhysiology (medical)medicineaineenvaihduntasystemaattiset kirjallisuuskatsauksetlcsh:QP1-981sports medicinebusiness.industrykuntoliikuntaLactate thresholdmeta-analyysilactic acidType 2 Diabetes Mellituslactate thresholdlaktaatitLactic acidBasal (medicine)chemistryAnesthesiaMeta-analysisHyperlactatemiaSystematic Reviewbusinessaikuistyypin diabetesfysiologiset vaikutukset
researchProduct

Cardiorespiratory Adaptations during Concurrent Aerobic and Strength Training in Men and Women

2015

This study investigated the effects of endurance followed by strength training (ES, men n = 16; women n = 15), the reverse exercise order (SE, men n = 18, women n = 13) and concurrent endurance and strength training performed on alternating days (AD, men n = 21, women n = 18) on cardiorespiratory parameters. Peak oxygen consumption ([Formula: see text]O2peak) and oxygen consumption at sub-maximal power outputs ([Formula: see text]O2submax) of 50 to 175 Watts in men and 50 to 125 Watts in women were assessed during an incremental cycling test both before and after 24 weeks of training. Increases in [Formula: see text]O2peak in both men and women were statistically larger in AD (18±9% and 25±…

AdultMalemedicine.medical_specialtyTime FactorsStrength trainingPhysical fitnesslcsh:MedicineCardiovascular Physiological PhenomenaYoung AdultOxygen ConsumptionHeart ratestrength trainingGroup interactionHumansMedicineMuscle StrengthExercise physiologylcsh:ScienceMuscle Skeletalta315ExerciseAnalysis of VarianceMultidisciplinarybusiness.industrylcsh:Rcardiorespiratory adaptationsta3141Cardiorespiratory fitnessaerobinen harjoitteluAdaptation PhysiologicalPhysical FitnessExercise TestPhysical EnduranceMuscle strengthPhysical therapylcsh:QFemalevoimaharjoitteluAnalysis of varianceaerobic trainingbusinessResearch ArticlePLOS ONE
researchProduct

Supervised Physical Training Enhances Muscle Strength but Not Muscle Mass in Prostate Cancer Patients Undergoing Androgen Deprivation Therapy: A Syst…

2019

Introduction: Androgen deprivation therapy (ADT) is considered the basic treatment for advanced prostate cancer, but it is highly associated with detrimental changes in muscle mass and muscle strength. The aim of this meta-analysis was to investigate the effects of supervised physical training on lean mass and muscle strength in prostate cancer patients undergoing ADT. Methods: A systematic literature search was performed using MEDLINE, Embase, and ScienceDirect until October 2018. Only studies that examined both muscle mass and strength in prostate cancer patients undergoing ADT were included. Outcomes of interest were changes in lean body mass (surrogate for muscle mass) as well as upper …

Oncologymedicine.medical_specialtyPhysiologyStrength trainingADTAndrogen suppressionlcsh:PhysiologyAndrogen deprivation therapy03 medical and health sciencesProstate cancer0302 clinical medicineProstatelean massPhysiology (medical)Internal medicinestrength trainingmedicineexercise medicineexercise oncologyLeg presssystemaattiset kirjallisuuskatsauksetandrogen suppressionsyöpähoidotlcsh:QP1-981business.industrymeta-analyysiCorrection030229 sport sciencesmedicine.diseasemedicine.anatomical_structurelihasmassa030220 oncology & carcinogenesisLean body massProstate neoplasmSystematic ReviewvoimaharjoittelubusinessliikuntahoitolihasvoimaFrontiers in Physiology
researchProduct

Physiological adaptations to resistance training in rats selectively bred for low and high response to aerobic exercise training

2018

New Findings: What is the central question of this study? Can phenotypic traits associated with low response to one mode of training be extrapolated to other exercise-inducible phenotypes? The present study investigated whether rats that are low responders to endurance training are also low responders to resistance training. What is the main finding and its importance? After resistance training, rats that are high responders to aerobic exercise training improved more in maximal strength compared with low-responder rats. However, the greater gain in strength in high-responder rats was not accompanied by muscle hypertrophy, suggesting that the responses observed could be mainly neural in orig…

Malemedicine.medical_specialtyprotein synthesisPhysiologyStimulationHindlimbPhysical strengthArticleMuscle hypertrophy03 medical and health sciences0302 clinical medicineEndurance trainingInternal medicinePhysical Conditioning AnimalMedicineAerobic exerciseAnimalsMuscle Strengthmuscle hypertrophyta315Muscle Skeletallihassolutfibre contractilitybusiness.industryResistance trainingResistance Training030229 sport sciencesGeneral Medicinemuscle stimulationAdaptation PhysiologicalRatsPhysiological AdaptationsEndocrinologyBody Compositionbusiness030217 neurology & neurosurgerylihasvoima
researchProduct

Mucosal immunity and upper respiratory tract symptoms in recreational endurance runners.

2015

The present study investigated the effects of a 12-week endurance-training intervention on salivary proteins and upper respiratory tract symptoms (URS) in 25 young men. Saliva samples of 25 recreational male endurance runners (age 34.6 years, body mass index = 23.8 kg·m−2, peak aerobic capacity = 47.2 mL·kg−1·min−1) were collected before (PRE) and after (POST) the training intervention, in a fasting state, as well as both before and after a maximal incremental treadmill run. The training consisted of both continuous and interval training sessions, 4–6 times per week based on the polarized training approach. Participants filled in Wisconsin Upper Respiratory Symptom Survey-21 and were retro…

AdultMalemedicine.medical_specialtySalivaPhysiologyEndocrinology Diabetes and MetabolismRespiratory SystemRespiratory Tract DiseasesGastroenterologyInterval trainingBody Mass IndexRunning03 medical and health sciencesBasal (phylogenetics)0302 clinical medicineWisconsinEndurance trainingPhysiology (medical)Internal medicineSurveys and QuestionnairesMedicineHumansRespiratory systemTreadmillSalivaImmunity MucosalDisease ResistanceRetrospective StudiesNutrition and Dieteticsbusiness.industryBody Weight030229 sport sciencesGeneral MedicineImmunoglobulin AEndocrinologyImmunoglobulin MSalivary alpha-AmylasesPhysical EnduranceSalivary alpha-AmylasesbusinessBody mass index030217 neurology & neurosurgeryBiomarkersApplied physiology, nutrition, and metabolism = Physiologie appliquee, nutrition et metabolisme
researchProduct

The comparison of cold-water immersion and cold air therapy on maximal cycling performance and recovery markers following strength exercises

2016

This study examined the effects of cold-water immersion (CWI) and cold air therapy (CAT) on maximal cycling performance (i.e. anaerobic power) and markers of muscle damage following a strength training session. Twenty endurance-trained but strength-untrained male (n = 10) and female (n = 10) participants were randomised into either: CWI (15 min in 14 °C water to iliac crest) or CAT (15 min in 14 °C air) immediately following strength training (i.e. 3 sets of leg press, leg extensions and leg curls at 6 repetition maximum, respectively). Creatine kinase, muscle soreness and fatigue, isometric knee extensor and flexor torque and cycling anaerobic power were measured prior to, immediately afte…

medicine.medical_specialtyDelayed onset muscle sorenessStrength trainingHydrostatic pressurelcsh:MedicineIsometric exerciseGeneral Biochemistry Genetics and Molecular Biology03 medical and health sciences0302 clinical medicineDelayed onset muscle sorenessmedicineCreatine kinaseta315Leg pressdelayed onset muscle sorenessbiologyPower outputcreatine kinasebusiness.industryGeneral Neurosciencelcsh:R030229 sport sciencesGeneral MedicineKinesiologySurgerypower outputAnesthesiabiology.proteinCreatine kinasevoimaharjoitteluStrength trainingmedicine.symptomGeneral Agricultural and Biological SciencesCyclingbusinessAnaerobic exercise030217 neurology & neurosurgeryPeerJ
researchProduct

Combined aerobic and resistance training decreases inflammation markers in healthy men

2017

Our primary aim was to study the effects of 24 weeks of combined aerobic and resistance training performed on the same day or on different days on inflammation markers. Physically active, healthy young men were randomly divided into three groups that performed: aerobic and resistance training consecutively in the same training session (SS) 2-3 days wk-1 or on alternating days (AD) 4-6 days wk-1 as well as control (C). The total training volume was matched in the training groups. The control group was asked to maintain their habitual physical activity and exercise level. Maximal leg press strength (1RM) and peak oxygen uptake (VO2peak ) were measured. Abdominal fat mass was estimated with du…

AdultLeptinMalemedicine.medical_specialtytulehdusarvotAdipokinePhysical Therapy Sports Therapy and RehabilitationPhysical exercise030204 cardiovascular system & hematologyliikunta03 medical and health sciences0302 clinical medicineOxygen Consumptionphysical exerciseInternal medicinemedicinelow-grade inflammationHumansOrthopedics and Sports MedicineResistinLeg pressta315ExerciseadipokinesChemokine CCL2InflammationbiologyAdiponectinbusiness.industryInterleukin-6Tumor Necrosis Factor-alphaLeptinC-reactive proteinabdominal fatVO2 maxResistance Training030229 sport sciencesEndocrinologyC-Reactive Proteinbiology.proteinBody CompositionResistinAdiponectinbusinessBiomarkersScandinavian Journal of Medicine and Science in Sports
researchProduct

Acute Neuromuscular and Endocrine Responses and Recovery to Single-Session Combined Endurance and Strength Loadings

2013

The purpose of this study was to investigate acute neuromuscular and endocrine responses and recovery to a single session of combined endurance and strength loading using 2 loading orders. Forty-two men were demographically matched to perform a single session of combined endurance + strength (E + S) or strength + endurance (S + E) loading. The strength loading was conducted on a leg press and included sets of power, maximal strength, and hypertrophic loads with an overall duration of 30 minutes. The endurance loading was conducted on a bike ergometer and performed by continuous cycling over 30 minutes at 65% of subject's individual maximal watts. Both loading conditions led to significant a…

AdultMalemedicine.medical_specialtyTime FactorsMovementOrder effectThyrotropinPhysical Therapy Sports Therapy and RehabilitationInternal medicineMaximal strengthmedicineHumansEndocrine systemTestosteroneOrthopedics and Sports MedicineLactic AcidMuscle StrengthExercise physiologyMuscle Skeletalta315Leg pressCreatine KinaseExerciseSerum testosteroneChemistryExplosive forceResistance TrainingGeneral MedicineBicyclingCross-Sectional StudiesEndocrinologyLower ExtremityGrowth HormonePhysical EnduranceSingle sessionJournal of Strength and Conditioning Research
researchProduct

Timing of Exercise Affects Glycemic Control in Type 2 Diabetes Patients Treated with Metformin

2018

Objective. The purpose of the study was to examine the acute effects of the timing of exercise on the glycemic control during and after exercise in T2D. Methods. This study included 26 T2D patients (14 women and 12 men) who were treated with metformin. All patients were tested on four occasions: metformin administration alone (Metf), high-intensity interval training (HIIT) performed at 30 minutes (EX30), 60 minutes (EX60), and 90 minutes (EX90) postbreakfast, respectively. Glucose, insulin, and superoxide dismutase (SOD) activity were examined. Results. Glucose decreased significantly after the exercise in EX30, EX60, and EX90. Compared with Metf, the decline in glucose immediately after th…

Blood GlucoseMaleTime Factorsendocrine system diseasesEndocrinology Diabetes and Metabolismmedicine.medical_treatmentmetformiiniajoitus (suunnittelu)Type 2 diabetes030204 cardiovascular system & hematologyHigh-Intensity Interval TrainingGastroenterologylcsh:Diseases of the endocrine glands. Clinical endocrinologyInterval training0302 clinical medicineEndocrinologyInsulinta315type 2 diabetes patientskuntoliikuntata3141Middle Agedtiming of exerciseMetforminFemaleHigh-intensity interval trainingmedicine.drugAdultmedicine.medical_specialtyArticle Subject030209 endocrinology & metabolism03 medical and health sciencesInternal medicineDiabetes mellitusmedicineHumansHypoglycemic AgentsExercise physiologyExerciseGlycemiclcsh:RC648-665business.industrySuperoxide DismutaseInsulinmedicine.diseaseDiabetes Mellitus Type 2verensokeriClinical Studyglycemic controlbusinessmetforminaikuistyypin diabetesJournal of Diabetes Research
researchProduct

Normal weight obesity and physical fitness in Chinese university students: an overlooked association

2018

Background The primary aim of this study was to examine the associations of normal weight obesity (NWO) with physical fitness in Chinese university students. As a secondary aim, we assessed whether possible differences in physical fitness between students classified as NWO and normal weight non-obese (NWNO) were mediated by skeletal muscles mass. Methods A total of 383 students (205 males and 178 females, aged 18–24 years) from two universities volunteered to participate in this study. Body height and weight were measured by standard procedures and body composition was assessed by bio-impedance analysis (InBody 720). NWO was defined by a BMI of 18.5–23.9 kg/m2 and a body fat percentage of >…

Malemedicine.medical_specialtyChinaAdolescentUniversitiesPhysical fitnessPhysical activityIdeal Body Weight030209 endocrinology & metabolismBody-mass indexBody fat percentageBody compositionBody Mass Index03 medical and health sciencesYoung AdultSkeletal muscle mass0302 clinical medicineEpidemiologymedicineHumans030212 general & internal medicineObesityAssociation (psychology)Muscle SkeletalStudents2. Zero hungerPublic healthbusiness.industryPhysical activity4. Educationlcsh:Public aspects of medicinePublic Health Environmental and Occupational Healthlcsh:RA1-1270Test (assessment)Normal weight obesityPhysical FitnessFemalebusinessBody mass indexDemographyResearch ArticleBMC Public Health
researchProduct

Effects of 12-Week Low or Moderate Dietary Acid Intake on Acid–Base Status and Kidney Function at Rest and during Submaximal Cycling

2018

Prolonged effects of dietary acid intake on acid–base status and kidney function have not yet been studied in an intervention study in healthy subjects. Dietary acid load can be estimated by calculating the potential renal acid load (PRAL) of foods. Effects of low-PRAL and moderate-PRAL diets on acid–base status and kidney function were investigated during a 12-week exercise training period. Healthy, 20–50-year-old men (n = 21) and women (n = 25) participated in the study and were randomly divided into low-PRAL and moderate-PRAL groups. Before (PRE), mid-phase (MID) and after the intervention (POST), the subjects participated in measurement sessions, where a 12-h urine sample and fasting bl…

Maleand promotion of well-beingKidney DiseasekestävyysharjoitteluPhysiology030204 cardiovascular system & hematologyKidneyruokavaliotchemistry.chemical_compound0302 clinical medicinedietary acid loadYoung adultta315kidney functionmunuaisetAcid-Base EquilibriumKidneyNutrition and Dieteticsdietary acid load; acid–base status; net acid excretion; exercise training; kidney functionHydrogen-Ion ConcentrationMiddle Agedmedicine.anatomical_structureacid–base statusFemaleCyclinglcsh:Nutrition. Foods and food supplyAdultBicarbonateacid-base statusRenal and urogenitalhappo-emästasapainoRenal functionlcsh:TX341-641Acid–base homeostasisnet acid excretionArticleYoung Adult03 medical and health sciencesFood SciencesClinical ResearchComplementary and Integrative HealthmedicineHumans3.3 Nutrition and chemopreventionMetabolic and endocrineNutrition6.7 PhysicalTraining periodbusiness.industryPreventionEvaluation of treatments and therapeutic interventionsResistance Training030229 sport sciencesPrevention of disease and conditionsDietchemistryExercise TestPhysical EnduranceNet acid excretionbusinessexercise trainingFood AnalysisFood ScienceNutrients; Volume 10; Issue 3; Pages: 323
researchProduct

OR-039 Normal-weight obesity and physical fitness in Chinese university students: an overlooked association

2018

Objective The primary aim of this study was to examine the associations of normal weight obesity with physical fitness in Chinese university students. As a secondary aim, we assessed whether possible differences in physical fitness between students classified as NWO and normal weight non-obese (NWNO) were mediated by skeletal muscles mass.&#x0D; Methods A total of 383 students (205 males and 178 females, aged 18–24 years) from two universities volunteered to participate in this study. Body height and weight were measured by standard procedures and body composition was assessed by a bio-impedance device (InBody 720). NWO was defined by a BMI of 18.5 - 23.9 kg/m2 and a body fat percentage of …

Normal weight obesitybusiness.industryBody heightLeisure timePhysical fitnessPhysiologyMedicineHealth riskbusinessFemale studentsBody fat percentageShuttle run testExercise Biochemistry Review
researchProduct

Is Structured Exercise Performed with Supplemental Oxygen a Promising Method of Personalized Medicine in the Therapy of Chronic Diseases?

2020

Aim: This systematic review aimed to explore the literature to identify in which types of chronic diseases exercise with supplemental oxygen has previously been utilized and whether this type of personalized therapy leads to superior effects in physical fitness and well-being. Methods: Databases (PubMed/MEDLINE, CINHAL, EMBASE, Web of knowledge and Cochrane Library) were searched in accordance with PRISMA. Eligibility criteria included adult patients diagnosed with any type of chronic diseases engaging in supervised exercise training with supplemental oxygen compared to normoxia. A random-effects model was used to pool effect sizes by standardized mean differences (SMD). Results: Out of the…

medicine.medical_specialtySupplemental oxygenmedicine.medical_treatmentPhysical fitnessMEDLINEMedicine (miscellaneous)lcsh:Medicineoxygen therapyCochrane LibraryArticleindividualized exercise prescriptionCoronary artery disease03 medical and health sciences0302 clinical medicineOxygen therapyMedicine030212 general & internal medicineFiO2krooniset tauditexercise medicinesystemaattiset kirjallisuuskatsauksetindividualized exercise prescription FiO2individualized exercise prescription FiO<sub>2</sub>happihoitoCOPDkuntoliikuntabusiness.industryclinical exercise sciencelcsh:Rclinical exercise science; exercise medicine; hyperoxia; individualized exercise prescription FiO2; oxygen therapymedicine.disease030228 respiratory systemPhysical therapyhyperoxiaPersonalized medicinebusinessliikuntahoitoJournal of Personalized Medicine
researchProduct

Acute neuromuscular and metabolic responses to combined strength and endurance loadings: the "order effect" in recreationally endurance trained runne…

2014

The study examined the acute neuromuscular and metabolic responses and recovery (24 and 48 h) to combined strength and endurance sessions (SEs). Recreationally endurance trained men (n = 12) and women (n = 10) performed: endurance running followed immediately by a strength loading (combined endurance and strength session (ES)) and the reverse order (SE). Maximal strength (MVC), countermovement jump height (CMJ), and creatine kinase activity were measured pre-, mid-, post-loading and at 24 and 48 h of recovery. MVC and CMJ were decreased (P0.05) at post-ES and SE sessions in men. Only MVC decreased in ES and SE women (P0.05). During recovery, no order differences in MVC were observed between…

AdultMalemedicine.medical_specialtyLactic acid bloodOrder effectPhysical Therapy Sports Therapy and RehabilitationElectromyographyRunningYoung AdultInternal medicineMaximal strengthmedicineHumansOrthopedics and Sports MedicineLactic AcidMuscle Strengthta315Creatine KinasePhysical Education and Trainingmedicine.diagnostic_testbiologybusiness.industryElectromyographyResistance TrainingMiddle Agedbody regionsReverse orderMuscle FatiguePhysical therapyCardiologybiology.proteinCountermovement jumpPhysical EnduranceCreatine kinaseFemalebusinessEnergy Metabolismhuman activitiesCreatine kinase activityJournal of sports sciences
researchProduct

Does sex hormone-binding globulin cause insulin resistance during pubertal growth?

2019

Background The directional influences between serum sex hormone-binding globulin (SHBG), adiposity and insulin resistance during pubertal growth remain unclear. The aim of this study was to investigate bidirectional associations between SHBG and insulin resistance (HOMA-IR) and adiposity from childhood to early adulthood. Methods Participants were 396 healthy girls measured at baseline (age 11.2 years) and at 1, 2, 4 and 7.5 years. Serum concentrations of estradiol, testosterone and SHBG were determined by ELISA, glucose and insulin by enzymatic photometry, insulin-like growth factor 1 (IGF-1) by time-resolved fluoroimmunoassays, whole-body fat mass by dual-energy X-ray absorptiometry and …

0301 basic medicinemedicine.medical_specialtypubertyGlobulinEndocrinology Diabetes and Metabolismmedicine.medical_treatment030209 endocrinology & metabolismlcsh:Diseases of the endocrine glands. Clinical endocrinology03 medical and health sciences0302 clinical medicineEndocrinologyInsulin resistanceSex hormone-binding globulinInternal medicineinsulin resistanceInternal Medicinemedicinesex hormone-binding globulinkehonkoostumussukupuolihormonitadipositylcsh:RC648-665biologybusiness.industryResearchInsulinmenarcheConfoundinginsuliiniresistenssimurrosikämedicine.diseasetytöt030104 developmental biologyEndocrinologyglobuliinitHomeostatic model assessmentMenarchebiology.proteinbusinesshormones hormone substitutes and hormone antagonistsEarly pubertyEndocrine Connections
researchProduct

Reliability and validity of a new accelerometer-based device for detecting physical activities and energy expenditure.

2018

Background Objective assessments of sedentary behavior and physical activity (PA) by using accelerometer-based wearable devices are ever expanding, given their importance in the global context of health maintenance. This study aimed to determine the reliability and validity of a new accelerometer-based analyzer (Fibion) for detecting different PAs and estimating energy expenditure (EE) during a simulated free-living day. Methods The study consisted of two parts: a reliability (n = 18) and a validity (n = 19) test. Reliability was assessed by a 45 min protocol of repeated sitting, standing, and walking (i.e., 3 × 15 min, repeated twice), using both Fibion and ActiGraph. Validity was assesse…

medicine.medical_specialtylcsh:MedicineContext (language use)Test validitySittingAccelerometerposture allocationGeneral Biochemistry Genetics and Molecular BiologyMotion03 medical and health sciences0302 clinical medicinePhysical medicine and rehabilitationmittauslaitteetsedentary behaviormedicine030212 general & internal medicineta315Activity trackerReliability (statistics)reliabiliteettiMathematicsGeneral Neurosciencelcsh:RActivity tracker030229 sport sciencesGeneral MedicineKinesiologyliikeGas analyzerSedentary behaviorPosture allocationEnergy expenditurevaliditeettiactivity trackerPublic HealthliikkuminenGeneral Agricultural and Biological Sciencesfyysinen aktiivisuusPeerJ
researchProduct

Effects of morning versus evening combined strength and endurance training on physical performance, muscle hypertrophy, and serum hormone concentrati…

2016

This study investigated the effects of 24 weeks of morning versus evening same-session combined strength (S) and endurance (E) training on physical performance, muscle hypertrophy, and resting serum testosterone and cortisol diurnal concentrations. Forty-two young men were matched and assigned to a morning (m) or evening (e) E + S or S + E group (mE + S, n = 9; mS + E, n = 9; eE + S, n = 12; and eS + E, n = 12). Participants were tested for dynamic leg press 1-repetition maximum (1RM) and time to exhaustion (Texh) during an incremental cycle ergometer test both in the morning and evening, cross-sectional area (CSA) of vastus lateralis and diurnal serum testosterone and cortisol concentrati…

MaleTime FactorsHydrocortisonePhysiologyEndocrinology Diabetes and MetabolismMuscle DevelopmentQuadriceps MuscleMuscle hypertrophy0302 clinical medicineTestosteroneLeg pressFatigueTestosteroneMorningNutrition and DieteticsGeneral MedicineCircadian Rhythmconcurrent trainingorder effecttime-of-dayAdultmedicine.medical_specialtyPatient DropoutsEveningWeight LiftingAthletic Performancecortisol03 medical and health sciencesEndurance trainingPhysiology (medical)Internal medicinemedicineHumansMuscle StrengthMuscle SkeletalExercisebusiness.industryResistance TrainingHypertrophy030229 sport sciencesmuscle cross-sectional areaBicyclingEndocrinologyPhysical performanceExercise TestPhysical Endurancetestosteronibusiness030217 neurology & neurosurgeryHormoneApplied Physiology, Nutrition, and Metabolism
researchProduct

Effects of resistance training frequency on cardiorespiratory fitness in older men and women during intervention and follow-up.

2017

This study investigated the effects of resistance training (RT) performed with different frequencies, including a follow-up period, on cardiorespiratory fitness in healthy older individuals. Eighty-eight men and women (69 ± 3 years, 167 ± 9 cm and 78 ± 14 kg) were randomly placed into four groups: training one- (M1 = 11, W1 = 12), two- (M2 = 7, W2 = 14), or three- (M3 = 11, W3 = 13) times-per-week or a non-training control group (MCon = 11, WCon = 9). During months 1–3, all subjects trained two-times-per-week while during the subsequent 6 months, training frequency was set according to the group. Oxygen consumption (cycling economy: CE), gross efficiency (GE), blood lactate concentrations (…

MaleAgingTime FactorsvanhuksetHematocritBiochemistryHemoglobins0302 clinical medicineEndocrinologyAbsorptiometry PhotonHeart Ratestrength trainingBlood lactate030212 general & internal medicineta315Leg pressFinlandmedicine.diagnostic_testcardiovascularAge FactorsTreatment OutcomeCardiorespiratory FitnessHematocritCardiologyBody Compositionsubmaximal oxygen consumptionFemalevoimaharjoitteluikääntyneetmedicine.medical_specialtyStrength trainingelderly03 medical and health sciencesOxygen ConsumptionInternal medicineHeart rateGeneticsmedicineHumansLactic AcidMuscle StrengthMolecular BiologyGross efficiencyGeriatric AssessmentAgedbusiness.industryResistance trainingCardiorespiratory fitnessResistance Training030229 sport sciencesCell Biologyaerobinen harjoitteluaerobicPhysical therapyExercise TestbusinessBiomarkersExperimental gerontology
researchProduct

Neuromuscular Adaptations to Same-Session Combined Endurance and Strength Training in Recreational Endurance Runners

2016

This study examined neuromuscular adaptations in recreational endurance runners during 24 weeks of same-session combined endurance and strength training (E+S, n=13) vs. endurance training only (E, n=14). Endurance training was similar in the 2 groups (4-6x/week). Additional maximal and explosive strength training was performed in E+S always after incremental endurance running sessions (35-45 min, 65-85% HRmax). Maximal dynamic leg press strength remained statistically unaltered in E+S but decreased in E at week 24 (-5±5%, p=0.014, btw-groups at week 12 and 24, p=0.014 and 0.011). Isometric leg press and unilateral knee extension force, EMG of knee extensors and voluntary activation remained…

AdultMalemedicine.medical_specialtyStrength trainingPhysical Therapy Sports Therapy and RehabilitationIsometric exerciseElectromyographyKnee extensionRunning03 medical and health sciences0302 clinical medicineEndurance trainingmedicineHumansOrthopedics and Sports MedicineMuscle Strength030212 general & internal medicineMuscle SkeletalLeg pressmedicine.diagnostic_testKnee extensorsElectromyographybusiness.industryResistance Training030229 sport sciencesAdaptation PhysiologicalRunning timeAnesthesiaExercise TestPhysical EndurancePhysical therapybusinessInternational Journal of Sports Medicine
researchProduct

Training-induced changes in daily energy expenditure: Methodological evaluation using wrist-worn accelerometer, heart rate monitor, and doubly labele…

2019

IntroductionWrist-mounted motion sensors can quantify the volume and intensity of physical activities, but little is known about their long-term validity. Our aim was to validate a wrist motion sensor in estimating daily energy expenditure, including any change induced by long-term participation in endurance and strength training. Supplemental heart rate monitoring during weekly exercise was also investigated.MethodsA 13-day doubly labeled water (DLW) measurement of total energy expenditure (TEE) was performed twice in healthy male subjects: during two last weeks of a 12-week Control period (n = 15) and during two last weeks of a 12-week combined strength and aerobic Training period (n = 13…

MalesykeFITNESSPhysiologyACCURACYphysical activityliikuntabioenergeticsAccelerometerBiochemistryFatsDAILY PHYSICAL-ACTIVITY0302 clinical medicineHeart Rateenergy metabolismAccelerometryheart ratestrength trainingMedicine and Health SciencesPublic and Occupational Health030212 general & internal medicineaineenvaihduntarasvatMultidisciplinaryexerciseQRWristLipidsSports ScienceTIMEINSIGHTSPhysiological ParametersStrength TrainingMedicinesykemittaritvoimaharjoittelufyysinen aktiivisuusResearch ArticlePhysical Conditioning HumanAdultmedicine.medical_specialtyfatsBODY-COMPOSITIONStrength trainingScienceCardiologyDrinkingDoubly labeled waterBioenergeticsbody weightWearable Electronic DevicesYoung Adult03 medical and health sciencesPhysical medicine and rehabilitationHeart ratemedicineHumansAerobic exerciseResting energy expenditureVALIDITYSports and Exercise MedicineDeuterium OxideExerciseLife StylebioenergetiikkaMonitoring PhysiologicINTENSITYbusiness.industryBody WeightHeart rate monitorBiology and Life SciencesWaterPhysical Activity030229 sport sciencesIntensity (physics)MetabolismPhysical FitnessPhysical EnduranceEnergy MetabolismPhysiological ProcessesbusinessPLOS ONE
researchProduct

The order effect of combined endurance and strength loadings on force and hormone responses: effects of prolonged training

2014

Purpose To examine acute responses and recovery of force and serum hormones to combined endurance and strength loadings utilizing different orders of exercises before and after training. Methods Physically active men were matched to an order sequence of endurance followed by strength (E + S, n = 12) or strength followed by endurance (S + E, n = 17). The subjects performed one experimental loading consisting of steady-state cycling and a leg press protocol before and after 24 weeks of order-specific combined training. Results No between-group difference in acute reductions of force was observed at week 0 (E + S −23 %, p < 0.001; S + E −22 %, p < 0.01) and 24 (E + S −25 %, p < 0.001; S + E −2…

AdultMalemedicine.medical_specialtyTime FactorsHydrocortisonePhysiologyOrder effectTraining adaptationsGrowth hormoneTestosterone bloodPhysical medicine and rehabilitationRecoveryPhysiology (medical)medicineHumansOrthopedics and Sports MedicineTestosteroneConcurrent trainingEndurance cyclingSerum hormonesFatigueCombined trainingbusiness.industryConcurrent trainingPublic Health Environmental and Occupational HealthResistance trainingResistance TrainingGeneral MedicineHuman physiologyCase-Control StudiesGrowth HormonePhysical therapyPhysical EndurancetestosteronibusinessHormone
researchProduct

Effects of endurance training only versus same-session combined endurance and strength training on physical performance and serum hormone concentrati…

2014

This study investigated the effects of endurance training only (E, n = 14) and same-session combined training, when strength training is repeatedly preceded by endurance loading (endurance and strength training (E+S), n = 13) on endurance (1000-m running time during incremental field test) and strength performance (1-repetition maximum (1RM) in dynamic leg press), basal serum hormone concentrations, and endurance loading-induced force and hormone responses in recreationally endurance-trained men. E was identical in the 2 groups and consisted of steady-state and interval running, 4–6 times per week for 24 weeks. E+S performed additional mixed-maximal and explosive-strength training (2 times…

AdultMalemedicine.medical_specialtyacute interferenceHydrocortisonePhysiologyStrength trainingEndocrinology Diabetes and MetabolismPhysical ExertionPhysical activityField testscortisolAthletic PerformanceRunningEndurance trainingPhysiology (medical)Sex Hormone-Binding GlobulinmedicineHumansTestosteroneMuscle StrengthExerciseendurance runningLegNutrition and Dieteticsbusiness.industryConcurrent trainingResistance TrainingGeneral Medicineendocrine adaptationsPhysical performanceconcurrent trainingPhysical therapyPhysical EnduranceRecreationtestosteronibusinessAlgorithmsApplied physiology, nutrition, and metabolism = Physiologie appliquee, nutrition et metabolisme
researchProduct

Neuromuscular Adaptations to Different Modes of Combined Strength and Endurance Training

2014

The present study investigated neuromuscular adaptations between same-session combined strength and endurance training with 2 loading orders and different day combined training over 24 weeks. 56 subjects were divided into different day (DD) combined strength and endurance training (4-6 d·wk(-1)) and same-session combined training: endurance preceding strength (E+S) or vice versa (S+E) (2-3 d·wk(-1)). Dynamic and isometric strength, EMG, voluntary activation, muscle cross-sectional area and endurance performance were measured. All groups increased dynamic one-repetition maximum (p<0.001; DD 13±7%, E+S 12±9% and S+E 17±12%) and isometric force (p<0.05-0.01), muscle cross-sectional area (p<0.0…

AdultMalemedicine.medical_specialtyAdolescentPhysical Therapy Sports Therapy and RehabilitationIsometric exerciseElectromyographyKnee extensionMuscle hypertrophyYoung AdultPhysical medicine and rehabilitationEndurance trainingInternal medicinemedicineHumansKneeOrthopedics and Sports MedicineMuscle StrengthPower outputMuscle SkeletalLegPhysical Education and Trainingmedicine.diagnostic_testElectromyographybusiness.industryConcurrent trainingResistance trainingResistance TrainingHypertrophyAdaptation PhysiologicalBicyclingEndocrinologyPhysical EndurancebusinessInternational Journal of Sports Medicine
researchProduct

Miten yhdistää voima- ja kestävyysharjoittelu urheilijalla, kuntoilijalla, lapsilla tai ikääntyneillä?

2015

Jyväskylän yliopiston liikuntabiologian laitos järjesti 23.–25.9.2015 kansainvälisen symposiumin koskien kestävyys- ja voimaharjoittelun yhdistämistä. Tapahtumaan osallistui yli 350 tutkijaa, valmentajaa, liikunta-alan ammattilaista sekä opiskelijaa yli 30 eri maasta. Kolmipäiväisen symposiumin aikana pohdittiin lukuisissa asiantuntijaesityksissä, miten niin urheilijoiden ja kuntoilijoiden kuin lasten ja ikääntyneiden tulisi yhdistää kestävyys- ja voimaharjoittelu, jotta kummastakin harjoittelumuodosta saataisiin mahdollisimman suuret hyödyt. nonPeerReviewed

suorituskykykestävyysharjoitteluvoimaharjoittelu
researchProduct

Normal weight obesity and physical fitness in Chinese university students: an overlooked association

2018

Background: The primary aim of this study was to examine the associations of normal weight obesity (NWO) with physical fitness in Chinese university students. As a secondary aim, we assessed whether possible differences in physical fitness between students classified as NWO and normal weight non-obese (NWNO) were mediated by skeletal muscles mass. Methods: A total of 383 students (205 males and 178 females, aged 18–24 years) from two universities volunteered to participate in this study. Body height and weight were measured by standard procedures and body composition was assessed by bio-impedance analysis (InBody 720). NWO was defined by a BMI of 18.5–23.9 kg/m2 and a body fat percentage of…

fyysinen kuntolihasmassakansanterveysrasvaprosenttibody-mass indexphysical activityskeletal muscle masspainoindeksifyysinen aktiivisuuskehonkoostumus
researchProduct

Validity of three smartwatches in estimating energy expenditure during outdoor walking and running.

2022

Commercially wrist-worn devices often present inaccurate estimations of energy expenditure (EE), with large between-device differences. We aimed to assess the validity of the Apple Watch Series 6 (AW), Garmin FENIX 6 (GF) and Huawei Watch GT 2e (HW) in estimating EE during outdoor walking and running. Twenty young normal-weight Chinese adults concurrently wore three index devices randomly positioned at both wrists during walking at 6 km/h and running at 10 km/h for 2 km on a 400- meter track. As a criterion, EE was assessed by indirect calorimetry (COSMED K5). For walking, EE from AW and GF was significantly higher than that obtained by the K5 (p &amp;lt; 0.001 and 0.002, respectively), but…

tarkkuusPhysiologyphysical activityälykellotmonitorointikävelyjuoksuvalidation accuracywearable deviceshealth monitoringvalidointiPhysiology (medical)mittarit (mittaus)puettava teknologiafyysinen aktiivisuusenergiankulutus (aineenvaihdunta)Frontiers in physiology
researchProduct

Additional file 1: of Normal weight obesity and physical fitness in Chinese university students: an overlooked association

2018

Participants characteristics stratified by gender and four weight group. (PDF 129 kb)

body regionsnervous systemfungi
researchProduct

Concurrent endurance and strength training : neuromuscular, cardiorespiratory and hormonal effects of the exercise order in previously untrained and …

2015

The aim of the present thesis was two-fold. First, to investigate physiological adaptations to concurrent endurance and strength training performed in the same session with different exercise orders (i.e. commencing training with endurance or strength, respectively; E+S vs. S+E) in previously untrained men (n=42) (study 1). Second, to examine physiological adaptations when strength training was always performed immediately after endurance running in the same session (E+S) compared to endurance training alone (E) in recreational endurance runners (n=30) (study 2). In study 1, training consisted of 2 - 3 weekly combined endurance cycling and mixed hypertrophic and maximal strength training se…

body compositionendurance runningcombined trainingkestävyysharjoitteluhermolihastoimintakasvuhormonitjärjestysverenkiertoelimetcortisolharjoitusvastehengityselimetcoachinghydrokortisonitestosteronegrowth hormoneendurance cyclingorder effectmiehetvoimaharjoittelutestosteronivalmennushormonaaliset vaikutuksetkehonkoostumus
researchProduct

Acute neuromuscular and endocrine responses and recovery to single session combined endurance and strength loadings: ‘Order effect’ in untrained youn…

2013

The purpose of this study was to investigate acute neuromuscular and endocrine responses and recovery to a single session of combined endurance and strength loading using two loading orders. Forty-two men were demographically matched to perform a single session of combined endurance+strength (E+S) or strength+endurance (S+E) loading. The strength loading was conducted on a leg press and included sets of power, maximal strength and hypertrophic loads with an overall duration of 30 minutes. The endurance loading was conducted on a bike ergometer and performed by continuous cycling over 30min at 65% of subject’s individual maximal Watts. Both loading conditions led to significant acute reducti…

explosive strengthserum hormonesTSHnopeusvoimatestosteronefatiguetestosteronicortisolmaximal force
researchProduct

Exercise precision medicine for type 2 diabetics : Targeted benefit or risk?

2023

Concurrent exercise and metformin administration may reduce the acute and chronic effects of exercise on glucose metabolism in patients with type 2 diabetes (T2D). However, several studies suggest that combing metformin and exercise treatment may have no additive effect and even cause adverse effects in T2D patients. This case report aimed to highlight the challenges associated with prescribing exercise to type 2 diabetes patients undergoing metformin treatment. A 67-years old woman was followed-up for 5 months, including assessment of the acute and chronic glucose and lactate metabolism induced by concomitant exercise and metformin. The findings were four-fold: 1) During a high-intensity i…

tapaustutkimusverensokeriglukoosiaineenvaihduntablood glucosecase reportexercise interventionexercise medicinehyperlactatemialaktaatitaikuistyypin diabetesliikuntahoito
researchProduct