0000000001330990

AUTHOR

Timo Törmäkangas

showing 113 related works from this author

Genetic and Environmental Effects on Telomere Length and Lung Function: A Twin Study.

2015

Background The purpose of the study was to estimate the heritability of leukocyte telomere length (LTL) and lung function and to examine whether LTL and lung function share genetic or environmental effects in common. Methods 386 monozygotic and dizygotic Finnish twin sisters (age 68.4±3.4 years) were included. Relative LTL was determined from peripheral blood DNA by qPCR. Lung function measures of FEV1, FVC, FEV1/FVC, and PEF were derived from spirometry. Genetic modeling was performed with MPlus statistical software. Results Univariate analysis revealed that in LTL, 62% (95% confidence interval 50-72) of the variance was explained by additive genetic and 38% (28-50) by unique environmental…

0301 basic medicineSpirometryAgingBivariate analysista3111Genetic correlation03 medical and health sciencesFEV1/FVC ratio0302 clinical medicineForced Expiratory VolumeLeukocytesTwins DizygoticMedicineHumansLungAgedmedicine.diagnostic_testbusiness.industryEnvironmental exposureta3142Environmental ExposureTwins Monozygoticrespiratory systemHeritabilityMiddle AgedTelomeretelomeresTwin studyConfidence intervalrespiratory tract diseases030104 developmental biology030228 respiratory systemSpirometrygenetic modelingFemaleGeriatrics and GerontologybusinessDemographyThe journals of gerontology. Series A, Biological sciences and medical sciences
researchProduct

Intellectual ability in young adulthood as an antecedent of physical functioning in older age.

2016

Objectives: low cognitive ability is associated with subsequent functional disability. Whether this association extends across adult life has been little studied. The aim of this study was to examine the association between intellectual ability in young adulthood and physical functioning during a 10-year follow-up in older age.Methods: three hundred and sixty persons of the Helsinki Birth Cohort Study (HBCS) male members, born between 1934 and 1944 and residing in Finland in 1971, took part in The Finnish Defence Forces Basic Intellectual Ability Test during the first 2 weeks of their military service training between 1952 and 1972. Their physical functioning was assessed twice using the Sh…

GerontologyMaleAgingPhysical fitnessIntelligencefyysinen toimintakykycognitive functioningArticleolder people03 medical and health sciencesYoung Adult0302 clinical medicinevanhuusintellectual abilitySurveys and QuestionnairesIntellectual disabilitymedicinephysical functioningHumans030212 general & internal medicineCognitive skillYoung adultSocioeconomic statusFinlandold ageAgedIntelligence TestsIntelligence quotientbusiness.industryAge Factorsta3141Cognitionta3142General MedicineMiddle Agedmedicine.diseaseVerbal reasoningMilitary PersonnelPhysical FitnessFemaleGeriatrics and GerontologyPsychologybusiness030217 neurology & neurosurgeryAge and ageing
researchProduct

Physical Activity After a Hip Fracture: Effect of a Multicomponent Home-Based Rehabilitation Program—A Secondary Analysis of a Randomized Controlled …

2017

Objectives To investigate the effect of a yearlong multicomponent rehabilitation program on the level of physical activity (PA) and the maintenance of the level of PA over 1-year follow-up among older people recovering from a recent hip fracture. Design Secondary analysis of a randomized, controlled, parallel-group trial. Setting Home-based rehabilitation; measurements in university laboratory. Participants Community-dwelling people (N=81) aged ≥60 years recovering from a hip fracture. Participants were randomly assigned to an intervention (n=40) or a control (n=41) group, on average, 42±23 days after discharge from the hospital. Intervention A yearlong intervention included evaluation and …

CounselingMalemedicine.medical_specialtymedicine.medical_treatmentphysical activityPhysical Therapy Sports Therapy and RehabilitationWalkingGeelaw.invention03 medical and health sciences0302 clinical medicinePhysical medicine and rehabilitationRandomized controlled triallawIntervention (counseling)Activities of Daily LivingmedicineHumans030212 general & internal medicineMobility LimitationExerciseGeneralized estimating equationta316AgedAged 80 and overHip fractureRehabilitationMini–Mental State Examinationmedicine.diagnostic_testHip Fracturesbusiness.industryRehabilitationta3141Odds ratiomedicine.diseaseHome Care ServiceslonkkamurtumatExercise Therapyhip fractureHip fracturesPhysical therapyPatient CompliancekuntoutusFemalebusinessfyysinen aktiivisuus030217 neurology & neurosurgeryArchives of Physical Medicine and Rehabilitation
researchProduct

Regular Strength and Sprint Training Counteracts Bone Aging: a 10- year Follow-up in Male Masters Athletes

2021

According to cross-sectional and interventional studies, high-intensity strength and impact-type training provide a powerful osteogenic stimulus even in old age. Longitudinal evidence on the ability of high-intensity training to attenuate age-related bone deterioration is currently lacking, however. This follow-up study assessed the role of continued strength and sprint training on bone aging in 40- to 85-year-old male sprinters (n=69) with long-term training background. pQCT-derived bone structural, strength and densitometric parameters of the distal tibia (5% distal-proximal tibia length) and tibial midshaft (50% length) were assessed at baseline and after 10 years. The groups of well-tra…

bone pQCTStrength trainingEndocrinology Diabetes and Metabolismeducation030209 endocrinology & metabolismEXERCISEDiseases of the musculoskeletal systempitkittäistutkimusMuskel- und KnochenstoffwechselAGING03 medical and health sciences0302 clinical medicineEndurance trainingMale Masters Athleteslongitudinal studiesharjoitteluMedicineHIGH‐IMPACT TRAININGOrthopedics and Sports MedicineTibia030304 developmental biologyOrthopedic surgeryOrthodonticsluusto0303 health sciencesexercisebiologykuntoliikuntabusiness.industryAthletesBone AgingagingLONGITUDINAL STUDIESOriginal Articlesbiology.organism_classificationmusculoskeletal systemSprint trainingikääntyminenCompressive strengthRC925-935SprintBONE pQCTMasters athletesRegular StrengthOriginal ArticlevoimaharjoittelubusinessRD701-811high‐impact training
researchProduct

Catechol-O-Methyltransferase Gene Polymorphism Is Associated with Skeletal Muscle Properties in Older Women Alone and Together with Physical Activity

2008

BackgroundMuscle strength declines on average by one percent annually from midlife on. In postmenopausal women this decrement coincides with a rapid decline in estrogen production. The genetics underlying the effects of estrogen on skeletal muscle remains unclear. In the present study, we examined whether polymorphisms within COMT and ESR1 are associated with muscle properties and assessed their interaction and their combined effects with physical activity.Methodology/principal findingsA cross-sectional data analysis was conducted with 434 63-76-year-old women from the population-based Finnish Twin Study on Aging. Body anthropometry, muscle cross-sectional area (mCSA), isometric hand grip a…

medicine.medical_specialtymedicine.drug_classScienceeducationPhysical activityWomen's Health/Menopause and Post-Reproductive Women's HealthCatechol O-Methyltransferase03 medical and health sciences0302 clinical medicinePolymorphism (computer science)Internal medicineHand strengthGenetics and Genomics/Population GeneticsMedicineHumansMuscle SkeletalExercise030304 developmental biologyAged0303 health sciencesMultidisciplinaryCatechol-O-methyl transferasePolymorphism Geneticbusiness.industryPhysiology/EndocrinologyQRSkeletal muscleESR1 and Skeletal MuscleMiddle Aged314 Health sciencesTwin studyCOMTEndocrinologymedicine.anatomical_structureEstrogenMedicineESR1 ja luurankolihasFemalePublic Health and Epidemiology/EpidemiologybusinessEstrogen receptor alpha030217 neurology & neurosurgeryResearch ArticlePLoS ONE
researchProduct

Trait-specific tracking and determinants of body composition: a 7-year follow-up study of pubertal growth in girls

2008

Abstract Background Understanding how bone (BM), lean (LM) and fat mass (FM) develop through childhood, puberty and adolescence is vital since it holds key information regarding current and future health. Our study aimed to determine how BM, LM and FM track from prepuberty to early adulthood in girls and what factors are associated with intra- and inter-individual variation in these three tissues. Methods The study was a 7-year longitudinal cohort study. BM, LM and FM measured using dual-energy X-ray absorptiometry, self-reported dietary information, leisure time physical activity (LTPA) and other factors were assessed one to eight times in 396 girls aged 10 to 13 years (baseline), and in 2…

AdultPercentilemedicine.medical_specialtyBone densityAdolescentPhysiologyMotherslcsh:MedicineMotor ActivityDiet SurveysCohort StudiesAbsorptiometry PhotonBone DensityPrepubertyInternal medicinemedicineHumansParent-Child RelationsChildMedicine(all)business.industrySiblingsBody WeightPubertylcsh:RGeneral MedicineHeritabilityMiddle AgedPedigreeEndocrinologyQuartileLean body massFemalebusinessBreast feedingCohort studyFollow-Up StudiesResearch ArticleBMC Medicine
researchProduct

Serum osteocalcin is not associated with glucose but is inversely associated with leptin across generations of nondiabetic women.

2012

The skeleton is recognized as an important player in energy metabolism through its interactions with other tissues. Whether the association of osteocalcin with glucose metabolism is age dependent has not been fully addressed.The objective of the study was to examine the age-specific association between different forms of osteocalcin and glucose and adipokines.This was a family-based study across three generations.The study was conducted at a university laboratory.Sixty-four daughter-premenopausal mother-maternal grandmother trios participated in the study.Fasting plasma glucose and insulin concentrations, serum total (tOC), carboxylated (cOC), and uncarboxylated (ucOC = tOC - cOC) osteocalc…

AdultBlood GlucoseLeptinmedicine.medical_specialtyAdolescentEndocrinology Diabetes and Metabolismmedicine.medical_treatmentClinical BiochemistryOsteocalcinAdipokineContext (language use)Carbohydrate metabolismBiochemistryBone and BonesEndocrinologyInsulin resistanceInternal medicinemedicineHumansInsulinAgedbiologyAdiponectinLeptinInsulinBiochemistry (medical)Age FactorsMiddle Agedmedicine.diseaseEndocrinologyPremenopauseOsteocalcinbiology.proteinFemaleAdiponectinInsulin ResistanceThe Journal of clinical endocrinology and metabolism
researchProduct

Longevity-related molecular pathways are subject to midlife “switch” in humans

2019

Emerging evidence indicates that molecular aging may follow nonlinear or discontinuous trajectories. Whether this occurs in human neuromuscular tissue, particularly for the noncoding transcriptome, and independent of metabolic and aerobic capacities, is unknown. Applying our novel RNA method to quantify tissue coding and long noncoding RNA (lncRNA), we identified ~800 transcripts tracking with age up to ~60 years in human muscle and brain. In silico analysis demonstrated that this temporary linear “signature” was regulated by drugs, which reduce mortality or extend life span in model organisms, including 24 inhibitors of the IGF‐1/PI3K/mTOR pathway that mimicked, and 5 activators that oppos…

0301 basic medicineAgingved/biology.organism_classification_rank.speciesMuscle Fibers SkeletallihaksetTranscriptome0302 clinical medicineGene expressionGene Regulatory NetworksRNA-Seqmedia_commonCerebral CortexNeuronsreactive oxygen speciesihoTOR Serine-Threonine Kinasesmitochondrial complex 1LongevityBrainNon-coding RNAAlzheimer'sECSITCell biologytranskriptio (biologia)mTORRNA Long NoncodingOriginal ArticleaivotSignal TransductionAdultTranscriptional ActivationskinIn silicomedia_common.quotation_subjectLongevityBiology03 medical and health sciencesHumanslong noncoding RNAskeletal muscleModel organismGeneSirolimusved/biologyagingRNACell BiologyTwins MonozygoticOriginal Articles030104 developmental biologyikääntyminenRNATranscriptome030217 neurology & neurosurgery
researchProduct

Voluntary Running Aids to Maintain High Body Temperature in Rats Bred for High Aerobic Capacity

2016

The production of heat, i.e., thermogenesis, is a significant component of the metabolic rate, which in turn affects weight gain and health. Thermogenesis is linked to physical activity (PA) level. However, it is not known whether intrinsic exercise capacity, aging, and long-term voluntary running affect core body temperature. Here we use rat models selectively bred to differ in maximal treadmill endurance running capacity (Low capacity runners, LCR and High capacity Runners, HCR), that as adults are divergent for aerobic exercise capacity, aging, and metabolic disease risk to study the connection between PA and body temperature. Ten high capacity runner (HCR) and ten low capacity runner (L…

0301 basic medicinemedicine.medical_specialtyAgingPhysiologyphysical activitylcsh:PhysiologyBody Temperatureruumiinlämpö03 medical and health sciencesGastrocnemius muscle0302 clinical medicinePhysiology (medical)Internal medicinemedicineAerobic exerciseTreadmillskeletal muscleta315Aerobic capacityOriginal ResearchCore (anatomy)lcsh:QP1-981business.industryagingSkeletal muscleta3141aerobic capacity030104 developmental biologyEndocrinologymedicine.anatomical_structurePhysical therapyaerobinen suorituskykymedicine.symptombusinesshuman activitiesThermogenesisWeight gain030217 neurology & neurosurgeryFrontiers in Physiology
researchProduct

Construct and predictive validity of a self-reported measure of preclinical mobility limitation.

2007

Abstract Manty M, Heinonen A, Leinonen R, Tormakangas T, Sakari-Rantala R, Hirvensalo M, von Bonsdorff MB, Rantanen T. Construct and predictive validity of a self-reported measure of preclinical mobility limitation. Objectives To validate self-reported preclinical mobility limitation concept and self-report assessment method against muscle power and walking speed, and to study the predictive validity of preclinical mobility limitation with respect to future risk of manifest mobility limitation. Design Observational prospective cohort study and cross-sectional analysis. Setting Research laboratory and community. Participants A total of 632 community-living (age range, 75−81y) women and men t…

Predictive validityMalemedicine.medical_specialtyActivities of daily livingCross-sectional studymedicine.medical_treatmentPsychological interventionPhysical Therapy Sports Therapy and RehabilitationDisability EvaluationPhysical medicine and rehabilitationPredictive Value of TestsRisk FactorsSurveys and QuestionnairesActivities of Daily LivingmedicineHumansProspective StudiesGeriatric AssessmentAgedAged 80 and overRehabilitationRehabilitationPreferred walking speedCross-Sectional StudiesMobility LimitationPhysical therapyObservational studyFemaleMorbidityPsychologyLocomotionFollow-Up StudiesArchives of physical medicine and rehabilitation
researchProduct

Does Serum 25-Hydroxyvitamin D Influence Muscle Development during Puberty in Girls? - A 7-Year Longitudinal Study

2013

Vitamin D is well known for its regulatory role in calcium and phosphate homeostasis, but its role in muscle mass and strength during growth remains inconclusive. We explored the association of serum 25-hydroxyvitamin D (25(OH)D) with muscle development in girls from 11 to 18-years old. Whole body lean tissue mass (LMWB), appendicular lean mass (aLM), muscle cross-sectional area at the lower leg (mCSA), maximal voluntary contraction of elbow flexors (MVC elbow) and knee extensors (MVC knee) were assessed in 217 girls aged 10-13 years (at baseline), 215 in 2-year and 226 in 7.5-year follow-up. Serum concentration of 25(OH)D and intact parathyroid hormone (PTH) were analyzed retrospectively a…

medicine.medical_specialtyLongitudinal studyAdolescentlcsh:MedicineParathyroid hormone25-Hydroxyvitamin DMuscle DevelopmentPolymorphism Single NucleotideCalcitriol receptorvitamin D deficiencyInternal medicinemedicineVitamin D and neurologyHumansLongitudinal StudiesMuscle StrengthVitamin Dlcsh:ScienceChildMultidisciplinarybusiness.industrylcsh:RPubertyConfoundinglongitudinal studyta3141murrosikäVitamin D Deficiencymedicine.diseaseEndocrinologyParathyroid HormoneBody CompositionLean body massMenarcheReceptors Calcitriolmuscle developmentlcsh:QCalciumFemalebusinessResearch ArticlePLoS ONE
researchProduct

Associations Between Physical and Executive Functions Among Community-Dwelling Older Men and Women

2022

Walking is a complex task requiring the interplay of neuromuscular, sensory, and cognitive functions. Owing to the age-related decline in cognitive and physical functions, walking may be compromised in older adults, for cognitive functions, especially poor performance in executive functions, is associated with slow walking speed. Hence, the aim of this study was to investigate the associations between different subdomains of executive functions and physical functions and whether the associations found differ between men and women. Multiple linear regression analysis was performed on data collected from 314 community-dwelling older adults who did not meet physical activity guidelines but had…

Malecognitionsex differenceskognitiomedicine.medical_specialtytoiminnanohjaus (psykologia)Physical fitnesssukupuolierotfyysinen toimintakykyPhysical Therapy Sports Therapy and RehabilitationSensory systemWalkinggaitTask (project management)Executive FunctionCognitionPhysical medicine and rehabilitationdual-task costtoimintakykymedicineHumansGaitAgedbusiness.industryRehabilitationCognitionExecutive functionsGait3142 Public health care science environmental and occupational healthWalking Speedkävely3141 Health care sciencePreferred walking speedFemaleMultiple linear regression analysisIndependent LivingGeriatrics and GerontologybusinessPsychologyGerontologyikääntyneet
researchProduct

Towards early risk biomarkers: serum metabolic signature in childhood predicts cardio-metabolic risk in adulthood

2021

Summary: Background: Cardiovascular diseases may originate in childhood. Biomarkers identifying individuals with increased risk for disease are needed to support early detection and to optimise prevention strategies. Methods: In this prospective study, by applying a machine learning to high throughput NMR-based metabolomics data, we identified circulating childhood metabolic predictors of adult cardiovascular disease risk (MetS score) in a cohort of 396 females, followed from childhood (mean age 11·2 years) to early adulthood (mean age 18·1 years). The results obtained from the discovery cohort were validated in a large longitudinal birth cohort of females and males followed from puberty to…

MaleGerontologyMedicine (General)Longitudinal studyApolipoprotein BbiomarkkeritDiseaseType 2 diabetesRisk FactorsInformed consentProspective StudiesChildProspective cohort studyFinlandmedia_commonFramingham Risk ScorebiologyRriskitekijätGeneral MedicineALSPACmetabolomicsaikuisuusCardiovascular DiseasesCohortMedicineBirth CohortFemaleResearch Papermedicine.medical_specialtyAdolescentlongitudinal-studypitkittäistutkimusGeneral Biochemistry Genetics and Molecular BiologyR5-920childrencardio-metabolic riskInternal medicinemedicineHumansmedia_common.cataloged_instanceEuropean unionApolipoproteins AApolipoproteins Bbusiness.industryPubertyCardio metabolic risklapsuusmedicine.diseaseCross-Sectional StudiesDiabetes Mellitus Type 2biology.proteinsydän- ja verisuonitauditaineenvaihduntatuotteetbusinessBiomarkersDeclaration of HelsinkieBioMedicine
researchProduct

A twin study on the heritability of walking ability among older women

2006

BACKGROUND This study examined the role of genetic and environmental factors explaining individual differences in women's walking ability in old age. METHODS A maximal walking speed test over 10 meters and a 6-minute walking endurance test were done under standard conditions among 92 monozygotic and 105 dizygotic pairs of twin sisters reared together, aged 63-75 years. RESULTS The mean maximum walking speed was 1.73 +/- 0.32 m/s and the mean distance covered in the 6-minute walking test was 525.6 +/- 77.3 m. Multivariate genetic modeling showed that a minor part of the variances in walking speed (16%, 95% confidence interval [CI]: 0%-54%) and endurance (20%, 95% CI: 0%-56%) were accounted f…

AgingMultivariate statisticsbusiness.industryWalking testWalkingEnvironmentMiddle AgedHeritabilityTwin studyConfidence intervalDevelopmental psychologyPreferred walking speedGenetic modelingPhysical EnduranceHumansMedicineFemaleGeriatrics and GerontologybusinessAgedDemography
researchProduct

Dual sensory loss and social participation in older Europeans

2013

The purpose of the study was to describe the prevalence of hearing difficulties, vision difficulties and dual sensory difficulties in 11 European countries, and to study whether sensory difficulties are associated with social inactivity in older Europeans. This cross-sectional study is based on the 2004 data collection of the Survey of Health, Ageing and Retirement in Europe comprising 27,536 men and women aged 50 years and older. Hearing and vision difficulties, as well as participation in seven different social activities were assessed using a structured computer-assisted personal interview. Logistic regression models were used for analyses. Altogether, 5.9 % of the participants reported …

Gerontologyaktiivisuusmedicine.medical_specialtyHealth (social science)Dual sensory lossVisionPublic healthhearing social participationSensory lossCognitionSensory systemOdds ratioSocial participationLogistic regressionSocial engagementActivityDevelopmental psychologyOddsAgeingikääntyminenHearingmedicineGeriatrics and GerontologyPsychologyOriginal InvestigationEuropean Journal of Ageing
researchProduct

Interactive effects of aging and aerobic capacity on energy metabolism-related metabolites of serum, skeletal muscle, and white adipose tissue

2021

ABSTRACTAerobic capacity is a strong predictor of longevity. With aging, aerobic capacity decreases concomitantly with changes in whole body metabolism leading to increased disease risk. To address the role of aerobic capacity, aging and their interaction on metabolism, we utilized rat models of low and high intrinsic aerobic capacity (LCRs/HCRs) and assessed the metabolomics of serum, muscle, and white adipose tissue (WAT). We compared LCRs and HCRs at two time points: Young rats were sacrificed at 9 months, and old rats were sacrificed at 21 months. Targeted and semi-quantitative metabolomics analysis was performed on ultra-pressure Liquid Chromatography Tandem Mass Spectrometry (UPLC-MS)…

0301 basic medicineAgingWhite adipose tissue030204 cardiovascular system & hematologychemistry.chemical_compound0302 clinical medicineTandem Mass SpectrometryMetabolitesaineenvaihduntametabolitesALL-CAUSE MORTALITY2. Zero hungerchemistry.chemical_classification0303 health sciencesmetabolomicsAmino acidmedicine.anatomical_structureCARDIOVASCULAR-DISEASEOBESITYaerobinen suorituskykyOriginal ArticleCARDIORESPIRATORY FITNESSARTIFICIAL SELECTIONmedicine.medical_specialtyAdipose Tissue WhiteEXERCISErasva-aineenvaihdunta03 medical and health sciencesMetabolomicsFATNESSAerobic capacityInternal medicinemedicineAnimalsMetabolomicsBeta (finance)Muscle SkeletalAerobic capacity030304 developmental biologyAMINO-ACID-METABOLISMFatty acid metabolismagingSkeletal muscleLipid metabolismCardiorespiratory fitnessMetabolismRatsaerobic capacityikääntyminen030104 developmental biologyEndocrinologyPHYSICAL-ACTIVITYchemistryFUEL SELECTIONaineenvaihduntatuotteet3111 Biomedicinekoe-eläinmallitGeriatrics and GerontologyEnergy MetabolismChromatography Liquid
researchProduct

Associations between the dimensions of perceived togetherness, loneliness, and depressive symptoms among older Finnish people

2017

Objectives: We studied the associations between perceived togetherness, depressive symptoms, and loneliness over a six-month period among 222 people aged 75–79 who reported loneliness or depressive mood at baseline. Method: The present cross-lagged models utilized baseline and six-month follow-up data of a randomized controlled trial that examined the effects of a social intervention on loneliness and depression (ISRCTN78426775). Dimensions of perceived togetherness, i.e. attachment, social integration, guidance, alliance, nurturance, and reassurance of worth, were measured with the Social Provisions Scale, depressive symptoms with a short form of the Geriatric Depression Scale, and lonelin…

MaleAgingvanhukset050109 social psychologylaw.invention0302 clinical medicineSocial integrationRandomized controlled trialmielenterveyslawCross-lagged modelingcross-lagged modeling030212 general & internal medicine10. No inequalityFinlandDepression (differential diagnoses)Depressionyhteisöllisyys05 social sciencesLonelinessta3141Psychiatry and Mental healthyksinäisyysFemaleGeriatric Depression ScalePshychiatric Mental Healthmedicine.symptomPsychologyikääntyneetmental healthClinical psychologymasennusmedicine.medical_specialtyModels Psychological03 medical and health sciencesyhteenkuuluvuusIntervention (counseling)SuomimedicineHumansInterpersonal Relations0501 psychology and cognitive sciencessocial needPsychiatryDepressive symptomsAgedSocial needLonelinessSocial provisionObject AttachmentMental healthsocial provisionGeriatrics and GerontologyGerontologyFollow-Up StudiesAging & Mental Health
researchProduct

Early Life Origins of All-Cause and Cause-Specific Disability Pension: Findings from the Helsinki Birth Cohort Study

2015

BackgroundThere is some evidence linking sub-optimal prenatal development to an increased risk of disability pension (DP). Our aim was to investigate whether body size at birth was associated with transitioning into all-cause and cause-specific DP during the adult work career.Methods10 682 people born in 1934-44 belonging to the Helsinki Birth Cohort Study had data on birth weight extracted from birth records, and on time, type and reason of retirement between 1971 and 2011 extracted from the Finnish Centre for Pensions.ResultsAltogether 21.3% transitioned into DP during the 40-year follow-up, mainly due to mental disorders, musculoskeletal disorders and cardiovascular disease. Average age …

MalePediatricsSTRESSCHILDHOODDETERMINANTSCohort StudiesDisability Evaluation3123 Gynaecology and paediatricsBody SizeMusculoskeletal Diseasesdisability pensionRetirementMultidisciplinaryMental DisordersQHazard ratioRta3141ta3142Middle AgedAGE 60Prenatal development3. Good healthCardiovascular DiseasesCohortMedicineFemaleResearch ArticleCohort studyRiskmedicine.medical_specialtyScienceBirth weightprenatal developmentmedicineHumansCORONARY-HEART-DISEASEDisabled PersonssyntymäpainoAgedDemographyProportional Hazards Modelsbusiness.industryProportional hazards modelbirth weightDisability pensionMental healthSIZEFETAL-GROWTHWEIGHTFOLLOW-UPbusinessFollow-Up StudiesDemographyPLoS ONE
researchProduct

EFFECT OF PHYSICAL ACTIVITY COUNSELING ON HOME CARE USE IN OLDER PEOPLE

2009

Gerontologybusiness.industryPhysical activityMedicineGeriatrics and GerontologybusinessOlder peopleJournal of the American Geriatrics Society
researchProduct

Personal goals and changes in life-space mobility among older people

2015

Abstract Objective Life-space mobility – the spatial extent of mobility in daily life – is associated with quality of life and physical functioning but may also be influenced by future orientation expressed in personal goals. The aim of this study was to explore how different personal goals predict changes in older people's life-space mobility. Methods This prospective cohort study with a 2-year follow-up included 824 community-dwelling people aged 75 to 90 years from the municipalities of Jyvaskyla and Muurame in Central Finland. As part of the Life-Space Mobility in Old Age study (LISPE), which was conducted between 2012 and 2014, the participants responded to the Life-Space Assessment an…

MaleGerontologyAgingActivities of daily livingEpidemiologyLife-space mobilityQuality of life (healthcare)Activities of Daily LivingHumansMedicineProspective StudiesMobility LimitationFuture orientationProspective cohort studyExercisePersonal goalsFinlandAgedAged 80 and overEstimationbusiness.industryCommunity participationPublic Health Environmental and Occupational Healthta3142Mobility LimitationLife spaceQuality of LifeFemaleOlder peoplebusinessGoalsPreventive Medicine
researchProduct

Job strain in the public sector and hospital in-patient care use in old age : a 28-year prospective follow-up

2014

Background: high job strain increases the risk of health decline, but little is known about the specific consequences and long-term effects of job strain on old age health. Objectives: purpose was to investigate whether physical and mental job strain in midlife was associated with hospital care use in old age. Methods: study population included 5,625 Finnish public sector employees aged 44–58 years who worked in blue- and white-collar professions in 1981. The number of in-patient hospital care days was collected from the Finnish Hospital Discharge Register for the 28-year follow-up period. Results: rates of hospital care days per 1,000 person-years for men were 7.78 (95% confidence interval…

GerontologyMaleAgingWorkStatistics as TopicsairaalahoitoRate ratioOccupational safety and healtholder people0302 clinical medicineRisk FactorsEpidemiologyMedicineTerveystiede - Health care science030212 general & internal medicineProspective StudiesepidemiologiakohorttitutkimusFinlandta3141General Medicineta3142Middle AgedResearch PapersHospitalizationPopulation studyFemaleepidemiology0305 other medical scienceCohort studyAdultEmploymentmedicine.medical_specialtyPhysical ExertionRisk AssessmentTime03 medical and health sciencesSex FactorsStress Physiologicalcohort studyHumansOccupational Healthtyön kurmittavuusAgedjob strain030505 public healthPublic SectorJob strainbusiness.industrykohortti tutkimusConfidence intervalikääntyminenageingOccupational stressGeriatrics and GerontologybusinessStress Psychologicalhospital careAge and Ageing
researchProduct

Does telomere length predict decline in physical functioning in older twin sisters during an 11-year follow-up?

2016

Background: Leucocyte telomere length (LTL) is known to be associated with mortality, but its association with age-related decline in physical functioning and the development of disability is less clear. This study examined the associations between LTL and physical functioning, and investigated whether LTL predicts level of physical functioning over an 11- year follow-up. Methods: Older mono- (MZ) and dizygotic (DZ) twin sisters (n=386) participated in the study. Relative LTL was measured by qPCR at baseline. Physical functioning was measured by 6-min walking distance and level of physical activity (PA). Walking distance was measured at baseline and at 3-year follow-up. PA was assessed by q…

0301 basic medicineAgingmissing data not at randomTwinsphysical activitysix-minute walking testENVIRONMENTAL-FACTORSDevelopmental psychologyPhysical functioningMAXIMAL WALKING SPEEDSix-minute walking testLeukocytesMedicinetwin studyFinlandtelomereHERITABILITYWOMENTwin studyASSOCIATIONGeneral MedicineMiddle AgedTelomere3142 Public health care science environmental and occupational healthSurvival RateCARDIOVASCULAR-DISEASEbiological agingDisease ProgressionFemalePhysical activityfyysinen toimintakykyMotor ActivityArticleBiological aging03 medical and health sciencesWalking distanceAGEDiseases in TwinsHumansMissing data not at randomMotor activityMobility LimitationMETAANALYSISAgedPhysical activitybusiness.industryMORTALITYDisease progressionRepeated measures designHeritabilityTwin study030104 developmental biology3121 General medicine internal medicine and other clinical medicineGeriatrics and GerontologyDANISH TWINSbusinessPhysical functioningDemographyForecasting
researchProduct

The Association Between Epigenetic Clocks and Physical Functioning in Older Women: A 3-Year Follow-up

2021

Abstract Background Epigenetic clocks are composite markers developed to predict chronological age or mortality risk from DNA methylation (DNAm) data. The present study investigated the associations between 4 epigenetic clocks (Horvath’s and Hannum’s DNAmAge and DNAm GrimAge and PhenoAge) and physical functioning during a 3-year follow-up. Method We studied 63- to 76-year-old women (N = 413) from the Finnish Twin Study on Aging. DNAm was measured from blood samples at baseline. Age acceleration (AgeAccel), that is, discrepancy between chronological age and DNAm age, was determined as residuals from linear model. Physical functioning was assessed under standardized laboratory conditions at b…

EpigenomicsAgingfyysinen toimintakykyEpigenesis Genetic03 medical and health sciences0302 clinical medicinePhysical functioningMedicineHumans030212 general & internal medicineEpigeneticsAssociation (psychology)030304 developmental biology0303 health sciencesbusiness.industryLinear modelRepeated measures designdNaMDNA MethylationMissing dataTwin studyDNA-metylaatioikääntyminenCross-Sectional Studiesepigenetiikkabiological aging3121 General medicine internal medicine and other clinical medicineFemaleGeriatrics and Gerontologybusinessepigenetic clockDemographyFollow-Up Studies
researchProduct

Type of retirement as a determinant of pre- and post-retirement hospital in-patient care use: a prospective study

2014

Background We examined prospectively the use of all-cause hospital in-patient care among public sector employees by using a 3-year pre- and post-retirement study window. Methods A total of 5269 participants of the Finnish Longitudinal Study of Municipal Employees had retired during January 1984 and July 2000. They had register-based data on retirement (non-disability retirement n = 3411, men 40%, and diagnose-specific disability retirement n = 1858, men 50%) and all-cause hospital in-patient admissions and discharges. Analyses were conducted using Generalized Estimating Equation model. Results The prevalence of hospital care use for non-disability retirees remained stable during the 6-year …

AdultMaleGerontologymedicine.medical_specialtyLongitudinal studyDiseaseRate ratiomedicineHumansIn patientProspective StudiesPsychiatryProspective cohort studyGeneralized estimating equationFinlandPublic Sectorbusiness.industryagingPublic sectorPublic Health Environmental and Occupational Healthta3142General MedicineMiddle AgedHospital careHospitalizationretirementFemalebusinesshospital careJournal of Public Health
researchProduct

Declining Physical Performance Associates with Serum FasL, miR-21, and miR-146a in Aging Sprinters.

2016

Aging is associated with systemic inflammation and cellular apoptosis accelerating physiological dysfunctions. Whether physically active way of life affects these associations is unclear. This study measured the levels of serum inflammatory and apoptotic molecules, their change over 10 years, and their associations with physical performance in sprint-trained male athletes. HsCRP, cell counts, HGB, FasL, miR-21, and miR-146a were measured cross-sectionally (n=67, 18–90 yrs) and serum FasL, miR-21, and miR-146a and their aging-related associations with physical performance were assessed over a 10-year follow-up (n=49, 50–90 yrs). The cross-sectional study showed positive age correlations for …

0301 basic medicineMaleAgingCelllcsh:MedicineSystemic inflammationBench pressFas ligandRunning0302 clinical medicineYoung adultpikajuoksijatAged 80 and overta3141General Medicineinflammatory responseMiddle Agedmedicine.anatomical_structuremedicine.symptomInflammation MediatorsResearch ArticleAdultmedicine.medical_specialtyFas Ligand ProteinArticle SubjectAdolescentGeneral Biochemistry Genetics and Molecular Biologysprinters03 medical and health sciencesYoung AdultInternal medicinemedicineHumansAgedGeneral Immunology and Microbiologybusiness.industryaginglcsh:R030229 sport sciencesphysical performanceCirculating MicroRNAMicroRNAs030104 developmental biologyEndocrinologyCross-Sectional StudiesPhysical performanceApoptosisPhysical FitnessImmunologybusinessBiomarkersFollow-Up StudiesBioMed research international
researchProduct

Towards early risk biomarkers: serum metabolic signature in childhood predicts cardio-metabolic risk in adulthood

2019

AbstractCardiovascular diseases have their origin in childhood. Early biomarkers identifying individuals with increased risk for disease are needed to support early detection and to optimize prevention strategies. By applying machine learning approach on high throughput NMR-based metabolomics data, we identified metabolic predictors of cardiovascular risk in circulation in a cohort of 396 females, followed from childhood (mean age 11.2 years) to early adulthood (mean age 18.1 years). The identified childhood metabolic signature included three circulating biomarkers robustly associating with increased cardiovascular risk in early adulthood (AUC = 0.641 to 0.802, all p<0.01). These associa…

Oncologymedicine.medical_specialtybusiness.industryEarly detectionCardio metabolic riskMean ageDiseaseCirculating biomarkersIncreased riskInternal medicineCohortEarly adulthoodmedicinebusiness
researchProduct

Why do older drivers reduce driving? Findings from three European countries

2003

The objective of this study was to find out the reasons, which lead drivers to reduce their driving in varying cultural settings. Data on the prevalence of reduced driving, the reasons for and factors associated with reduced driving were obtained from Finnish, German and Italian home-dwelling active drivers (n=710) aged 55 and older. The subjects were interviewed in autumn 1995 at their homes with a standardized questionnaire as a part of the European project Keeping the Elderly Mobile: Technology to Meet Their Outdoor Mobility Needs. In the Finnish and German samples 62% and in the Italian sample 44% of the active drivers stated that they had reduced their driving. These persons drove fewe…

Engineeringbusiness.industryPoison controlHuman factors and ergonomicsTransportationSample (statistics)Suicide preventionOccupational safety and healthTransport engineeringTravel behaviorKilometerAutomotive EngineeringInjury preventionbusinessApplied PsychologyCivil and Structural EngineeringDemographyTransportation Research Part F: Traffic Psychology and Behaviour
researchProduct

Do opposite ends of same factors underlie life satisfaction vs. depressive symptoms among older people?

2021

Abstract Background Although depressive symptoms are more common among older than younger age groups, life satisfaction tends to remain stable over the life course, possibly because the underlying factors or processes differ. Aim To study whether the factors that increase the likelihood of high life satisfaction also decrease the likelihood of depressive symptoms among older people. Methods The data were a population-based probability sample drawn from community-dwelling people aged 75, 80, and 85 years (n = 1021). Participants’ life satisfaction was measured with the Satisfaction with Life Scale and depressive symptoms with the Centre for Epidemiologic Studies Depression Scale (CES-D). Phy…

masennusAgingMental well-beinghyvinvointiPopulationPersonal SatisfactionLife resourcesEmotional well-being03 medical and health scienceshenkinen hyvinvointi0302 clinical medicinelife resourcesmedicineHumans030212 general & internal medicineeducationDepressive symptomsAgededucation.field_of_studyDepressionLonelinessaged peopleLife satisfactionLonelinessmental well-beingExecutive functionsemotional well-beingEmotional well-beingCross-Sectional StudiesAged peopletyytyväisyysScale (social sciences)Life course approachOriginal ArticleGeriatrics and Gerontologymedicine.symptomPsychologyikääntyneet030217 neurology & neurosurgeryClinical psychologyAging clinical and experimental research
researchProduct

Factors associated with maximal walking speed among older community-living adults.

2011

Background and aims: The relative contribution of different domains on walking speed is largely unknown. This study investigated the central factors associated with maximal walking speed among older people. Methods: Cross-sectional analyses of baseline data from the SCAMOB study (ISRCTN 07330512) involving 605 community-living ambulatory adults aged 75–81 years. Maximal walking speed, leg extensor power, standing balance and body mass index were measured at the research center. Physical activity, smoking, use of alcohol, chronic diseases and depressive symptoms were self-reported by standard questionnaires. Results: The mean maximal walking speed was 1.4 m/s (range 0.3–2.9). In linear regre…

AdultMaleAgingmedicine.medical_specialtyPosturePhysical activityWalkingModels BiologicalBody Mass IndexPhysical medicine and rehabilitationCommunity livingLinear regressionPostural BalanceMedicineHumansGaitFinlandAgedRandomized Controlled Trials as TopicAged 80 and overbusiness.industrymedicine.diseaseObesityPreferred walking speedCross-Sectional StudiesAmbulatoryPhysical therapyFemaleHousing for the ElderlyGeriatrics and GerontologybusinessBody mass indexAging clinical and experimental research
researchProduct

Walking recovery after a hip fracture: A prospective follow-up study among community-dwelling over 60-year old men and women

2014

Purpose. Recovery of walking outdoors after hip fracture is important for equal participation in the community. The causes of poor recovery are not fully understood. This study investigates recovery of walking outdoors and associated determinants after hip fracture.Methods. A prospective follow-up study, among clinical sample of 81 community-dwelling hip fracture patients over 60 years. Perceived difficulty in walking outdoors and 500 meters was assessed before fracture, at discharge to home (3.2 ± 2.2 weeks after surgery), and on average 6.0 ± 3.3 weeks after discharge. Potential determinants for walking recovery were assessed. Linear latent trajectory model was used to analyse changes dur…

Malemedicine.medical_specialtyArticle Subjectmedicine.medical_treatmentlcsh:MedicinePoison controlWalkingwalking difficultyLogistic regressionSuicide preventionGeneral Biochemistry Genetics and Molecular BiologyOccupational safety and healthInjury preventionmedicineHumansExerciseAgedAged 80 and overHip fractureRehabilitationGeneral Immunology and MicrobiologyHip Fracturesbusiness.industrylcsh:Routdoor walkingHuman factors and ergonomicsta3141General MedicinePrognosismedicine.diseaseliikkuvuusPhysical therapyFemalebusinesshuman activitiesResearch ArticleFollow-Up StudiesBioMed Research International
researchProduct

Long-term leisure-time physical activity and other health habits as predictors of objectively monitored late-life physical activity – A 40-year twin …

2018

AbstractIMPORTANCEModerate-to-vigorous physical activity (MVPA) in old age is an important indicator of good health and functional capacity enabling independent living.OBJECTIVETo investigate whether physical activity and other health habits at ages 31-48 years predict objectively measured MVPA decades later.DESIGN, SETTING, AND PARTICIPANTSThis prospective twin cohort study in Finland comprised 616 individuals (197 complete twin pairs, including 91 monozygotic pairs, born 1940-1944), who responded to baseline questionnaires in 1975, 1981, and 1990, and participated in accelerometer monitoring at follow-up (mean age, 73 years).EXPOSURESPrimary exposure was long-term leisure-time physical ac…

MaleMultivariate statisticsFITNESSMonozygotic twinphysical activitylcsh:MedicineDETERMINANTS030204 cardiovascular system & hematologyOverweightCohort StudiesCorrelationHabits0302 clinical medicineEpidemiologyMedicineProspective Studies030212 general & internal medicinelcsh:Sciencetwin stydy2. Zero hungerMultidisciplinarySEDENTARY BEHAVIORRegression analysisMiddle Agedleisure-time3142 Public health care science environmental and occupational healthFemalemedicine.symptomHealth habitsvapaa-aikafyysinen aktiivisuusCohort studymedicine.medical_specialtyPhysical activityArticleSTYLE03 medical and health sciencesLeisure ActivitiesHumansOLDER-ADULTSExerciseSocioeconomic statusAgedMonitoring Physiologickaksostutkimusbusiness.industryDISABILITYMORTALITYlcsh:Rhealth habits030229 sport sciencesTwin studykaksosetpredictorsMOBILITYterveyskäyttäytyminenMultivariate AnalysisRISK-FACTORSlcsh:QFOLLOW-UPbusinessBody mass indexIndependent livingDemographyScientific Reports
researchProduct

Self-reported hearing difficulties and changes in life-space mobility among community-dwelling older adults: a Two-year follow-Up study

2015

Background Life-space mobility reflects individuals’ actual mobility and engagement with society. Difficulty in hearing is common among older adults and can complicate participation in everyday activities, thus restricting life-space mobility. The aim of this study was to examine whether self-reported hearing predicts changes in life-space mobility among older adults. Methods We conducted a prospective cohort study of community-dwelling older adults aged 75–90 years (n = 848). At-home face-to-face interviews at baseline and telephone follow-up were used. Participants responded to standardized questions on perceived hearing at baseline. Life-space mobility (the University of Alabama at Birmi…

MaleGerontologyAgingLongitudinal studymedicine.medical_specialtyTime FactorsActivities of daily livingHearing lossAudiologyCohort Studies03 medical and health sciences0302 clinical medicineHearingQuality of lifeActivities of Daily Livingmedicinelife-spaceHumansInterpersonal RelationsProspective Studies030212 general & internal medicineHearing LossProspective cohort studyGeneralized estimating equationAgedAged 80 and overLife-spacebusiness.industryagingCohortlongitudinal studycohorthearingCohortQuality of LifeFemaleIndependent LivingSelf ReportLongitudinal studymedicine.symptomGeriatrics and Gerontologybusiness030217 neurology & neurosurgeryResearch ArticleFollow-Up StudiesCohort studyBMC Geriatrics
researchProduct

Reliability and validity of the COPE Index among caregivers of disabled people.

2017

Aim To study the reliability and validity of the Carers of Older People in Europe (COPE) Index among caregivers of disabled people of different ages. Methods A cross-sectional design of Finnish caregivers (n = 1117). Exploratory factor analysis (EFA) was performed separately on samples of three different age groups, and the internal consistencies of the subscales were investigated. Results Three factors were identified; Cronbach's alpha was 0.83–0.86 for negative impact and 0.77–0.78 for quality of support, indicating good internal consistency. The third factor, positive value, was less consistent across the age groups (α < 0.66). Conclusions The COPE Index is a valid and reliable screening…

MalevalidityIndex (economics)Cross-sectional studymedia_common.quotation_subjectcross-sectional studiesfactor analysisDisabled people03 medical and health sciences0302 clinical medicineCronbach's alphaomaishoitajatInternal consistencyHumansQuality (business)Disabled Persons030212 general & internal medicineGeneral NursingReliability (statistics)caregivermedia_commonAgedreliabilityReproducibility of Resultsta3141Middle AgedExploratory factor analysisfaktorianalyysiEuropeCaregiversvaliditeettiFemalePsychology030217 neurology & neurosurgeryClinical psychologyApplied nursing research : ANR
researchProduct

Perceived stress symptoms in midlife predict disability in old age: a 28-year prospective cohort study.

2013

Background Stress has damaging effects on individual's health. However, information about the long-term consequences of mental stress is scarce. Methods This 28-year prospective cohort study examined on the associations between midlife stress and old age disability among 2,994 Finnish municipal professionals aged 44-58 years at baseline. Self-reported stress symptoms were assessed at baseline in 1981 and 4 years later in 1985 and perceived disability in 2009. For the baseline data, principal component analysis was used for differentiation into stress symptom profiles. The regression coefficient estimates for self-care disability (activities of daily living) and instrumental activities of da…

GerontologyAdultMalemedicine.medical_specialtyAgingActivities of daily livingLogistic regressionCohort StudiesRisk FactorsEpidemiologyActivities of Daily LivingmedicineHumansDecompensationDisabled PersonsProspective StudiesMobility LimitationProspective cohort studyFinlandAgedAged 80 and overbusiness.industryPublic healthta3141Cognitionta3142Odds ratioMiddle AgedFemaleGeriatrics and GerontologybusinessStress PsychologicalThe journals of gerontology. Series A, Biological sciences and medical sciences
researchProduct

Effect of Physical Activity Counseling on Disability in Older People: A 2-Year Randomized Controlled Trial

2008

OBJECTIVES: To study the effect of a physical activitycounseling intervention on instrumental activity of dailyliving (IADL) disability.DESIGN: Primary care–based, single-blind, randomizedcontrolled trial.SETTING: City of Jyva¨skyla¨, central Finland.PARTICIPANTS: Six hundred thirty-two people aged 75to 81 who were able to walk 500 meters without assistance,were at most moderately physically active, had a Mini-Mental State Examination score greater than 21, had nomedical contraindications for physical activity, and gaveinformed consent for participation.INTERVENTION: A single individualized physical activitycounseling session with supportive phone calls from a physio-therapist every 4 month…

GeriatricsGerontologymedicine.medical_specialtyRandomizationActivities of daily livingbusiness.industryPhysical exerciseDirective Counselinglaw.inventionClinical trialRandomized controlled triallawIntervention (counseling)medicinePhysical therapyGeriatrics and Gerontologybusinesshuman activitiesJournal of the American Geriatrics Society
researchProduct

Adipose Tissue Dysfunction and Altered Systemic Amino Acid Metabolism Are Associated with Non-Alcoholic Fatty Liver Disease

2015

Article

MaleMagnetic Resonance Spectroscopymedicine.medical_treatmentBiopsyAdipose tissuelcsh:MedicineFats0302 clinical medicineNon-alcoholic Fatty Liver DiseaseMetabolitesTerveystiede - Health care scienceSkeletal musclesAmino Acidslcsh:ScienceNon-U.S. Gov'tchemistry.chemical_classification0303 health sciencesMultidisciplinaryResearch Support Non-U.S. Gov'tFatty liverFatty AcidsrasvamaksaMiddle Aged3. Good healthAmino acidmedicine.anatomical_structureAdipose TissueLiverFemaleResearch Articlemedicine.medical_specialtyAdipose tissue030209 endocrinology & metabolismamino acid metabolismBiologyResearch Support03 medical and health sciencesInsulin resistanceInternal medicineFatty livermedicineJournal ArticleHumansObesityFatty acids030304 developmental biologyfatty liverCatabolismInsulinta1184lcsh:RFatty acidSkeletal muscleta3121medicine.diseaseEndocrinologychemistrylcsh:QGene expression
researchProduct

Barriers to outdoor physical activity and unmet physical activity need in older adults

2014

Abstract Objective To profile participants based on reported outdoor physical activity barriers using a data-driven approach, describe the profiles and study their association with unmet physical activity need. Method Cross-sectional analyses of 848 community-dwelling men and women aged 75–90 living in Central Finland in 2012. Barriers to outdoor physical activity and unmet physical activity need were enquired with a questionnaire. The latent profiles were identified by profiling participants into latent groups using a mixture modeling technique on the multivariate set of indicators of outdoor physical activity barriers. A path model was used to study the associations of the profiles with u…

MaleGerontologyAgingEpidemiologyHealth StatusPhysical activityWalkingEnvironmentCohort StudiesSurveys and QuestionnairesHumansMedicineoutdoor environmentMobility LimitationExerciseGeriatric AssessmentFinlandAgedAged 80 and overbusiness.industryagingPublic Health Environmental and Occupational Healthta3141Cross-Sectional StudiesliikkuvuusMixture modelingEnvironment DesignFemalebusinessOlder peoplePreventive Medicine
researchProduct

Retirement as a predictor of physical functioning trajectories among older businessmen

2022

Abstract Background Associations between retirement characteristics and consequent physical functioning (PF) are poorly understood, particularly in higher socioeconomic groups, where postponing retirement has had both positive and negative implications for PF. Methods Multiple assessments of PF, the first of which at the mean age of 73.3 years, were performed on 1709 men who were retired business executives and managers, using the RAND-36/SF-36 instrument, between 2000 and 2010. Questionnaire data on retirement age and type of pension was gathered in 2000. Five distinct PF trajectories were created using latent growth mixture modelling. Mortality- and covariate-adjusted multinomial regressi…

Malefyysinen toimintakykyage at retirementtype of pensionPensionsAGESurveys and Questionnairesphysical functioningHumansDisabled PersonsAgedWORKRetirementyrittäjätMORTALITYDISABILITYAge at retirementASSOCIATIONADULTSLOWER-EXTREMITY FUNCTIONDISEASES3121 General medicine internal medicine and other clinical medicineeläkkeelle siirtymineneläkeikämiehetLIFE-STYLEGeriatrics and Gerontologyhuman activitiesPhysical functioningikääntyneetType of pensionMIDLIFE
researchProduct

Effect of a social intervention of choice vs. control on depressive symptoms, melancholy, feeling of loneliness, and perceived togetherness in older …

2016

Objectives: This study examined effects of a social intervention on depressive symptoms, melancholy, loneliness, and perceived togetherness in community-dwelling Finnish older people. Method: Promotion of mental well-being in older people (GoodMood; ISRCTN78426775) was a single-blinded randomized control trial lasting 1.5 years. Two hundred and twenty-three persons aged 75–79 years reporting symptoms of loneliness or melancholy were randomized into intervention and control groups. The intervention group was allowed to choose among supervised exercise, social activity, or personal counseling. Follow-up measurements were conducted at the end of 6-month intervention, and at 3, 6, and 12 months…

CounselingMalemelankoliaAgingvanhuksetIntervention grouplaw.inventionolder people0302 clinical medicineSocial integrationdepressive symptomsRandomized controlled triallawSingle-Blind Method030212 general & internal medicineFinlandmedia_commonDepressionsocial integrationLonelinessta3141ta3142Exercise Therapy3. Good healthPsychiatry and Mental healthOutcome and Process Assessment Health CareFeelingyksinäisyysFemalePshychiatric Mental Healthmedicine.symptomPsychologyRCTikääntyneetClinical psychologymasennusmedia_common.quotation_subject03 medical and health sciencesIntervention (counseling)medicineHumansInterpersonal RelationsseuraelämäDepressive symptomsAgedDepressive Disorder030214 geriatricsLonelinesssosiaalisuussosiaalinen integraatioGeriatrics and GerontologyoireetOlder peopleGerontologyFollow-Up Studies
researchProduct

Working hours and sleep duration in midlife as determinants of health-related quality of life among older businessmen

2017

Background long working hours and short sleep duration are associated with a range of adverse health consequences. However, the combined effect of these two exposures on health-related quality of life (HRQoL) has not been investigated. Methods we studied white men born between 1919 and 1934 in the Helsinki Businessmen Study (HBS, initial n = 3,490). Data on clinical variables, self-rated health (SRH), working hours and sleep duration in 1974, and RAND-36 (SF-36) HRQoL survey in the year 2000 were available for 1,527 men. Follow-up time was 26 years. By combining working hours and sleep duration, four categories were formed: (i) normal work (≤50 hours/week) and normal sleep (>47 hours/week);…

MaleGerontologyAgingTime FactorsHealth StatusVitalityOccupational safety and healtholder peopleDisability Evaluation0302 clinical medicineQuality of lifeRisk FactorsSurveys and QuestionnairesMedicine030212 general & internal medicineProspective cohort studyFinlandSmokingAge Factorsta3142General MedicineMiddle AgedSleep in non-human animalshealth-related quality of lifeJob Descriptionworking hoursSF-36Personnel Staffing and SchedulingWorkloadWhite People03 medical and health sciencesvammaisuusSex FactorsHumansSocial determinants of healthOccupational HealthAgedbusiness.industryConfidence intervaltyöaikaikääntyminendisabilityageingLinear ModelsQuality of Lifesleep durationGeriatrics and GerontologySleepbusiness030217 neurology & neurosurgeryAge and Ageing
researchProduct

Mortality Risk Among Older People Who Did Versus Did Not Sustain a Fracture: Baseline Prefracture Strength and Gait Speed as Predictors in a 15-Year …

2019

Abstract Background Physiological reserve, as indicated by muscle strength and gait speed, may be especially determinant of survival in people who are exposed to a health stressor. We studied whether the association between strength/speed and mortality risk would be stronger in the time period after a fracture compared to other time periods. Methods Participants were population-based sample of 157 men and 325 women aged 75 and 80 years at baseline. Maximal 10-m gait speed and maximal isometric grip and knee extension strength were tested at the baseline before the fracture. Subsequent fracture incidence and mortality were followed up for 15 years. Cox regression analysis was used to estimat…

MaleRiskkuolleisuusAgingmedicine.medical_specialtyPopulationfyysinen toimintakykyvanhuksetPoison controlIsometric exercise030204 cardiovascular system & hematologyFractures Bone03 medical and health sciencesphysical function0302 clinical medicineInjury preventionHumansMedicineMuscle Strength030212 general & internal medicineepidemiologiaeducationGeriatric AssessmentluunmurtumatFinlandAgedAged 80 and overeducation.field_of_studyProportional hazards modelbusiness.industryIncidenceIncidence (epidemiology)Survival AnalysisGaitadverse eventsWalking SpeedPreferred walking speedfracturePhysical therapyFemaleepidemiologyGeriatrics and Gerontologybusinesshealth stressorsikääntyneetThe Journals of Gerontology: Series A
researchProduct

Does Social Activity Decrease Risk for Institutionalization and Mortality in Older People?

2012

Objectives. Social inactivity predicts adverse health events, but less is known about how different dimensions of social activity are related to health. The aim of this study was to investigate collective (e.g., cultural and organizational activities) and productive (e.g., helping others) social activity as predictors of risk for mortality and institutionalization in old age. Method. A total of 1,181 community-living people aged 65–84 years at baseline were interviewed face to face as part of the Evergreen project, in Jyvaskyla, Finland in 1988. Time to institutionalization and mortality were analyzed in separate models for proportional hazard regression on mortality and competing risks ana…

MaleGerontologyActivities of daily livingSocial PsychologyInstitutionalisationHealth StatusSocial EnvironmentFace-to-faceSocial supportInterpersonal relationshipResidence CharacteristicsRisk FactorsActivities of Daily LivingHumansInterpersonal RelationsMortalityGeriatric AssessmentLife StyleAgedAged 80 and overInstitutionalizationSocial SupportSocial environmentta3141HazardClinical PsychologySocioeconomic FactorsFemaleGeriatrics and GerontologyOlder peoplePsychologyGerontologyFollow-Up StudiesThe Journals of Gerontology Series B: Psychological Sciences and Social Sciences
researchProduct

Early life body mass trajectories and mortality in older age: Findings from the Helsinki Birth Cohort Study

2014

Overweight and obesity in childhood have been linked to an increased risk of adult mortality, but evidence is still scarce.We identified trajectories of body mass index (BMI) development in early life and investigated their mortality risk. Data come from the Helsinki Birth Cohort Study, in which 4943 individuals, born 1934-1944, had serial measures of weight and height from birth to 11 years extracted from health care records, weight and height data in adulthood, and register-based mortality data for 2000-2010.Three early BMI trajectories (increasing, average, and average-to-low for men and increasing, average, and low-to-high BMI for women) were identified. Women with an increasing or low-…

AdultMaleRiskPediatricsmedicine.medical_specialtyAgingDatabases Factualbody mass indexOverweightChildhood obesityImpaired glucose toleranceCohort StudiesBreast cancerCause of DeathNeoplasmsmedicineHumansEarly childhoodChildFinlandAgedbusiness.industryBody WeightAge FactorsInfant NewbornBayes Theoremta3141General MedicineMiddle AgedOverweightgrowth mixture modelsmedicine.diseaseObesitymortalitydevelopmental origins of adult health and diseaseChild PreschoolFemalelife-course epidemiologymedicine.symptomBirth cohortbusinessBody mass indexbirth sizeAnnals of Medicine
researchProduct

Aging and serum exomiR content in women-effects of estrogenic hormone replacement therapy.

2017

AbstractExosomes participate in intercellular messaging by transporting bioactive lipid-, protein- and RNA-molecules and -complexes. The contents of the exosomes reflect the physiological status of an individual making exosomes promising targets for biomarker analyses. In the present study we extracted exosome microRNAs (exomiRs) from serum samples of premenopausal women (n = 8) and monozygotic postmenopausal twins (n = 10 female pairs), discordant for the use of estrogenic hormone replacement therapy (HRT), in order to see whether the age or/and the use of HRT associates with exomiR content. A total of 241 exomiRs were detected by next generation sequencing, 10 showing age, 14 HRT and 10 a…

0301 basic medicineMICRORNASTranscriptomeMedicineGene Regulatory NetworksMultidisciplinaryEstradiolmicroRNAEstrogen Replacement TherapyEndocrine system and metabolic diseasesHigh-Throughput Nucleotide Sequencingta3141Middle AgedMenopausePostmenopauseDISCORDANTPOSTMENOPAUSAL WOMENTransgender hormone therapymiRNAsBiomarker (medicine)SKELETAL-MUSCLEFemaleAdultEXPRESSIONmedicine.medical_specialtyMENOPAUSEBODY-COMPOSITIONexosomesta3111ExosomeArticleestrogenic hormone replacement therapy03 medical and health sciencesBreast cancerInternal medicineHumansBREAST-CANCERbusiness.industryta1184Gene Expression ProfilingReproducibility of Resultsbiomarkersmedicine.diseaseGene expression profilingMONOZYGOTIC TWIN PAIRS030104 developmental biologyEndocrinologyPremenopauseCELLSNext-generation sequencing3111 Biomedicinemikro-RNAbusinessTranscriptomeHormone
researchProduct

Developing an Assessment Method of Active Aging: University of Jyvaskyla Active Aging Scale

2018

Objective: To develop an assessment method of active aging for research on older people. Method: A multiphase process that included drafting by an expert panel, a pilot study for item analysis and scale validity, a feedback study with focus groups and questionnaire respondents, and a test–retest study. Altogether 235 people aged 60 to 94 years provided responses and/or feedback. Results: We developed a 17-item University of Jyvaskyla Active Aging Scale with four aspects in each item (goals, ability, opportunity, and activity; range 0-272). The psychometric and item properties are good and the scale assesses a unidimensional latent construct of active aging. Discussion: Our scale assesses ol…

MaleAgingaktiivisuusPsychometricsScale (ratio)Computer scienceProcess (engineering)hyvinvointiPilot Projectspsychometric properties03 medical and health sciences0302 clinical medicinewell-beingSurveys and QuestionnairesActivities of Daily LivingparticipationHumans030212 general & internal medicineGeriatric AssessmentAgedosallistuminenAged 80 and overCommunity and Home Care030505 public healthItem analysisactivityagingReproducibility of ResultsArticlesManufacturing engineeringpsykometriikkaikääntyminenAssessment methodsFemalePublic HealthGeriatrics and Gerontology0305 other medical scienceOlder peopleGerontologyJournal of Aging and Health
researchProduct

Force Platform Balance Measures as Predictors of Indoor and Outdoor Falls in Community-Dwelling Women Aged 63-76 Years

2008

Background. Inability to maintain balance while standing increases risk of falls in older people. The present study assessed whether center of pressure (COP) movement measured with force platform technology predicts risk for falls among older people with no manifest deficiency in standing balance. Methods. Participants were 434 community-dwelling women, aged 63-76 years. COP was measured in six stances on a force platform. Following balance tests, participants reported their falls with 12 monthly calendars. Incidence rate ratios (IRR) with 95% confidence intervals (CI) were computed from negative binomial regression models. For the analysis, those with>/=1 fall indoors were coded"indoor fal…

Agingmedicine.medical_specialtyTime FactorsPoison controlSuicide preventionStatistics NonparametricOccupational safety and healthPredictive Value of TestsRisk FactorsInjury preventionPressuremedicinePostural BalanceHumansForce platformProspective StudiesPostural BalanceFinlandAgedbusiness.industryMiddle AgedConfidence intervalPhysical therapyRegression AnalysisAccidental FallsFemaleGeriatrics and Gerontologymedicine.symptombusinessBalance problemsDemographyThe Journals of Gerontology Series A: Biological Sciences and Medical Sciences
researchProduct

Satisfaction With Present Life Predicts Survival in Octogenarians

2006

We examined the effect of life satisfaction on survival over 10 years among 80-year-old and older same-sex twins of whom 320 individuals responded to the Life Satisfaction Index Z questionnaire in connection with the OCTO-Twin study. We treated participants as individuals in semiparametric Cox regression mixed-effects models (frailty) by adjusting the similarity of mortality risk within twin pairs by modeling it as a random variable. An exploratory factor analysis yielded three factors: Zest and Mood represented satisfaction with present life and Congruence represented satisfaction with past life. Those in the lowest quartile of factors of satisfaction with present life had an almost twofol…

Aged 80 and overMaleGerontologyZestSurvivalSocial PsychologyProportional hazards modelConfoundingTwinsLife satisfactionPersonal SatisfactionModels PsychologicalTwin studyClinical PsychologyMoodQuartileQuality of lifeSurveys and QuestionnairesQuality of LifeHumansFemaleGeriatrics and GerontologyPsychologyGerontologyDemographyThe Journals of Gerontology Series B: Psychological Sciences and Social Sciences
researchProduct

Effects of a 20-week high-intensity strength and sprint training program on tibial bone structure and strength in middle-aged and older male sprint a…

2017

This randomized, controlled, high-intensity strength and sprint training trial in middle-aged and older male sprint athletes showed significant improvements in mid-tibial structure and strength. The study reveals the adaptability of aging bone, suggesting that through a novel, intensive training stimulus it is possible to strengthen bones during aging. High-load, high-speed and impact-type exercise may be an efficient way of improving bone strength even in old age. We evaluated the effects of combined strength and sprint training on indices of bone health in competitive masters athletes, who serve as a group of older people who are likely to be able to participate in vigorous exercise of th…

0301 basic medicineAdultMalemedicine.medical_specialtyAgingbone pQCTStrength trainingEndocrinology Diabetes and Metabolismluuntiheys030209 endocrinology & metabolismAthletic Performancelaw.inventionRunning03 medical and health sciences0302 clinical medicinePhysical medicine and rehabilitationRandomized controlled triallawBMDBone DensitymedicineHumansTibial boneAgedpikajuoksijatAged 80 and overAnthropometryTibiabusiness.industrykuntoliikuntaHigh intensityhigh-impact trainingmasters athleteMiddle AgedSprint training030104 developmental biologyikääntyminenSprintAthletesOrthopedic surgeryMasters athletesPhysical therapyaikuisurheiluPatient CompliancevoimaharjoittelubusinessTomography X-Ray ComputedikääntyneetPhysical Conditioning HumanOsteoporosis international : a journal established as result of cooperation between the European Foundation for Osteoporosis and the National Osteoporosis Foundation of the USA
researchProduct

Fear of Moving Outdoors and Development of Outdoor Walking Difficulty in Older People

2009

OBJECTIVES: To study which individual characteristics and environmental factors correlate with fear of moving outdoors and whether fear of moving outdoors predicts development of mobility limitation. DESIGN: Observational prospective cohort study and cross-sectional analyses. SETTING: Community and research center. PARTICIPANTS: Seven hundred twenty-seven community-living people aged 75 to 81 were interviewed at baseline, of whom 314 took part in a 3.5-year follow-up. MEASUREMENTS: Fear of moving outdoors and its potential individual and environmental correlates were assessed at baseline. Perceived difficulties in walking 0.5 km and 2 km were assessed twice a year over a 3.5-year period. RE…

GerontologyGeriatricsmedicine.medical_specialtybusiness.industryPoison controlHuman factors and ergonomicsSuicide preventionOccupational safety and healthPreferred walking speedDifficulty walkingInjury preventionMedicineGeriatrics and GerontologybusinessJournal of the American Geriatrics Society
researchProduct

Inter-individual variation of the urinary steroid profiles in Swedish and Norwegian athletes.

2020

The steroidal module of the Athlete Biological Passport (ABP) aims to detect doping with endogenous steroids, e.g. testosterone (T), by longitudinally monitoring several biomarkers. These biomarkers are ratios combined into urinary concentrations of testosterone and metabolically related steroids. However, it is evident after 5 years of monitoring steroid passports that there are large variations in the steroid ratios complicating its interpretation. In this study, we used over 11000 urinary steroid profiles from Swedish and Norwegian athletes to determine both the inter- and intra-individual variations of all steroids and ratios in the steroidal passport. Furthermore, we investigated if th…

AdultMaleAgingUrinary systemmedicine.medical_treatmentPharmaceutical SciencePhysiologyUrineNorwegian01 natural sciencesAnalytical ChemistrySteroid03 medical and health sciencesYoung Adult0302 clinical medicineAnabolic AgentsmedicineEnvironmental ChemistryHumans030216 legal & forensic medicineLongitudinal StudiesSpectroscopyTestosteroneUrine Specimen CollectionDoping in SportsSwedenSex CharacteristicsbiologyAthletesbusiness.industryNorway010401 analytical chemistryConfoundingbiology.organism_classificationlanguage.human_language0104 chemical sciencesCircadian RhythmSubstance Abuse DetectionEndogenous steroidslanguageFemaleSteroidsSeasonsbusinessBiomarkersSportsDrug testing and analysisREFERENCES
researchProduct

Erratum to: Dual sensory loss and social participation in older Europeans

2013

The purpose of the study was to describe the prevalence of hearing difficulties, vision difficulties and dual sensory difficulties in 11 European countries, and to study whether sensory difficulties are associated with social inactivity in older Europeans. This cross-sectional study is based on the 2004 data collection of the Survey of Health, Ageing and Retirement in Europe comprising 27,536 men and women aged 50 years and older. Hearing and vision difficulties, as well as participation in seven different social activities were assessed using a structured computer-assisted personal interview. Logistic regression models were used for analyses. Altogether, 5.9 % of the participants reported …

GerontologyHealth (social science)Geriatrics gerontologySensory lossGeriatrics and GerontologyDUAL (cognitive architecture)ErratumPsychologySocial engagement
researchProduct

Normal weight obesity and physical fitness in Chinese university students: an overlooked association

2018

Background The primary aim of this study was to examine the associations of normal weight obesity (NWO) with physical fitness in Chinese university students. As a secondary aim, we assessed whether possible differences in physical fitness between students classified as NWO and normal weight non-obese (NWNO) were mediated by skeletal muscles mass. Methods A total of 383 students (205 males and 178 females, aged 18–24 years) from two universities volunteered to participate in this study. Body height and weight were measured by standard procedures and body composition was assessed by bio-impedance analysis (InBody 720). NWO was defined by a BMI of 18.5–23.9 kg/m2 and a body fat percentage of >…

Malemedicine.medical_specialtyChinaAdolescentUniversitiesPhysical fitnessPhysical activityIdeal Body Weight030209 endocrinology & metabolismBody-mass indexBody fat percentageBody compositionBody Mass Index03 medical and health sciencesYoung AdultSkeletal muscle mass0302 clinical medicineEpidemiologymedicineHumans030212 general & internal medicineObesityAssociation (psychology)Muscle SkeletalStudents2. Zero hungerPublic healthbusiness.industryPhysical activity4. Educationlcsh:Public aspects of medicinePublic Health Environmental and Occupational Healthlcsh:RA1-1270Test (assessment)Normal weight obesityPhysical FitnessFemalebusinessBody mass indexDemographyResearch ArticleBMC Public Health
researchProduct

Long-term effect of physical activity counseling on mobility limitation among older people: a randomized controlled study.

2009

Background. Physical activity counseling increases physical activity among older people, but its effectiveness on mobility, that is, maintaining the ability to move independently, is unknown. We studied the effect of physical activity counseling on mobility among older people and evaluated whether counseling-induced benefi ts persist after cessation of the intervention. Methods. In a 2-year, single-blinded, randomized controlled study, 632 sedentary participants aged 75 – 81 years were randomly assigned into the intervention ( n = 318) or control ( n = 314) group. The intervention group received a single individualized physical activity counseling session with a supportive telephone contact…

MaleAgingmedicine.medical_specialtyActivities of daily livingTime FactorsPhysical activityDirective CounselingMotor ActivityDirective Counselinglaw.inventionDisability EvaluationRandomized controlled triallawIntervention (counseling)Surveys and QuestionnairesActivities of Daily LivingmedicineHumansSingle-Blind MethodMobility LimitationAgedRetrospective StudiesAged 80 and overbusiness.industryRetrospective cohort studyOdds ratioArticlesExercise TherapyMobility LimitationPhysical therapyFemaleGeriatrics and GerontologybusinessAttitude to HealthFollow-Up StudiesThe journals of gerontology. Series A, Biological sciences and medical sciences
researchProduct

Effect of physical activity counseling on physical activity of older people in Finland (ISRCTN 07330512).

2011

SUMMARY The aim of this study was to describe the underlying theory and the implementation of a 2-year individualized physical activity counseling intervention and to evaluate whether benefits persisted 1.5 years after the intervention. The sample included 632 sedentary 75- to 81-year-old participants. Data were collected in 2003 –2005. The participants were randomly assigned to an intervention group and a control group. The intervention consisted of an individualized face-to-face meeting followed by telephone contacts every 4 months for 2 years, with the aim to increase participation in specific physical activities as well as to increase habitual physical activity. At the 2-year follow-up,…

CounselingMalemedicine.medical_specialtyAgingHealth (social science)Strength trainingHealth PromotionResidence CharacteristicsIntervention (counseling)Statistical significancemedicineAerobic exerciseHumansExerciseFinlandAgedAged 80 and overMotivationbusiness.industryIncidence (epidemiology)Public Health Environmental and Occupational HealthOdds ratioConfidence intervalSelf EfficacyPhysical therapyCalisthenicsFemalebusinessHealth promotion international
researchProduct

The Development of Generativity in Middle Adulthood and the Beginning of Late Adulthood: A Longitudinal Study from Age 42 to 61

2023

AbstractPrevious studies have yielded mixed results regarding the development of generativity during adulthood. Longitudinal data were utilized to investigate the average development of generativity between the ages of 42 and 61 as well as individual differences in terms of its development. The study used data from the Jyväskylä Longitudinal Study of Personality and Social Development (JYLS) (initial N = 369). The data consisted of 291 individuals whose generativity scores, measured using the Generativity Scale, were available at age 42, 50, or 61. Rasch analysis was utilized to form a generativity measure. The development of generativity between the measurements was investigated in women a…

adulthoodlongitudinalExperimental and Cognitive Psychologypitkittäistutkimusmuutospsychosocial developmentlatent change score modelyksilögenerativityaikuisuusDevelopmental and Educational PsychologykehitysLife-span and Life-course Studiesindividual differencesJournal of Adult Development
researchProduct

Power training and postmenopausal hormone therapy affect transcriptional control of specific co-regulated gene clusters in skeletal muscle

2010

At the moment, there is no clear molecular explanation for the steeper decline in muscle performance after menopause or the mechanisms of counteractive treatments. The goal of this genome-wide study was to identify the genes and gene clusters through which power training (PT) comprising jumping activities or estrogen containing hormone replacement therapy (HRT) may affect skeletal muscle properties after menopause. We used musculus vastus lateralis samples from early stage postmenopausal (50–57 years old) women participating in a yearlong randomized double-blind placebo-controlled trial with PT and HRT interventions. Using microarray platform with over 24,000 probes, we identified 665 diffe…

AgingCandidate geneTranscription GeneticvaihdevuodetmenopaussiBioinformaticsEstrogen deprivation0302 clinical medicineGene expressionestrogenTranscriptional regulation0303 health sciencesEstrogen Replacement TherapyGeneral MedicineMiddle AgedestrogeeniPostmenopausemedicine.anatomical_structureFemalevoimaharjoitteluMenopausemedicine.symptomTranscriptome-wide studymedicine.medical_specialtyPlyometric trainingmedicine.drug_classBiologyArticletranskriptomin laajuuinen tutkimus03 medical and health sciencesplyometrinen harjoitteluInternal medicinemedicineHumansSkeletal muscle characteristicsKEGGMuscle SkeletalExerciseGene030304 developmental biologyhormonikorvaushoitoSkeletal muscleMuscle weaknessdeprivaatioPower trainingAgeingEndocrinologyluurankolihaksetHormone replacement therapyEstrogenGeriatrics and Gerontology030217 neurology & neurosurgeryAGE
researchProduct

Longitudinal associations of high‐volume and vigorous‐intensity exercise with hip fracture risk in men

2022

Maintenance of vigorous exercise habits from young to old age is considered protective against hip fractures, but data on fracture risk in lifelong vigorous exercisers are lacking. This longitudinal cohort study examined the hazard of hip fractures in 1844 male former athletes and 1216 population controls and in relation to exercise volume and intensity in later years. Incident hip fractures after age 50 years were identified from hospital discharge register from 1972 to 2015. Exercise and covariate information was obtained from questionnaires administered in 1985, 1995, 2001, and 2008. Analyses were conducted using extended proportional hazards regression model for time-dependent exposures…

MaleLONG-TERMEndocrinology Diabetes and MetabolismosteoporoosiPARTICIPATIONEXERCISEpitkittäistutkimusOSTEOPOROSISDISEASEAGINGTIME PHYSICAL-ACTIVITYRisk FactorsHumansQUALITYlongitudinal studiesOrthopedics and Sports MedicineluunmurtumatAgedProportional Hazards ModelsREGISTERexerciseHip FractureskuntoliikuntaagingLONGITUDINAL STUDIESMiddle AgedosteoporosislonkkaFRACTURE PREVENTIONLIFESIZEikääntyminenBALANCE3121 General medicine internal medicine and other clinical medicinefracture preventionmiehetBONE-MINERAL DENSITYikääntyneet
researchProduct

Menopause modulates the circulating metabolome: evidence from a prospective cohort study

2022

Abstract Aims We studied the changes in the circulating metabolome and their relation to the menopausal hormonal shift in 17β-oestradiol and follicle-stimulating hormone levels among women transitioning from perimenopause to early postmenopause. Methods and results We analysed longitudinal data from 218 Finnish women, 35 of whom started menopausal hormone therapy during the study. The menopausal transition was monitored with menstrual diaries and serum hormone measurements. The median follow-up was 14 months (interquartile range: 8–20). Serum metabolites were quantified with targeted nuclear magnetic resonance metabolomics. The model results were adjusted for age, follow-up duration, educat…

estradiolivaihdevuodetEpidemiologyCholesterol HDLmenopauseoestradiolCholesterol LDLmetabolomicscardiovascular diseaseshormonaaliset tekijäthormone replacement therapyaineenvaihduntahäiriötsydän- ja verisuonitaudithormonihoitoMetabolomeHumansaineenvaihduntatuotteetFemaleProspective StudiesMenopauseCardiology and Cardiovascular MedicinekohorttitutkimusaineenvaihduntaTriglyceridesEuropean Journal of Preventive Cardiology
researchProduct

Visual Acuity and Mortality in Older People and Factors on the Pathway

2008

To examine vision as a predictor of mortality in older people and the role of mobility, depressed mood, chronic diseases, body mass index, physical activity and injurious accidents in this possible association.223 persons aged 75 and 193 persons aged 80 years at the baseline participated in visual acuity measurements. Visual acuity (VA) of0.3 in the better eye was defined as visual impairment, VA ofor = 0.3 butor = 0.5 as lowered vision and VA0.5 as normal VA. Death dates were received from the official register. Cox regression models were used to determine the relative risks of mortality and to study what factors lie on the pathway from poor vision to mortality.Over the 10-year follow-up, …

MaleAgingPediatricsmedicine.medical_specialtyVisual acuityEpidemiologyVisual impairmentVisual AcuityVision LowPoison controlDisability EvaluationPhysical medicine and rehabilitationRisk FactorsInjury preventionmedicineHumansFinlandAgedRetrospective StudiesAged 80 and overProportional hazards modelbusiness.industryAge FactorsRetrospective cohort studySurvival RateOphthalmologyRelative riskFemalemedicine.symptombusinessBody mass indexOphthalmic Epidemiology
researchProduct

Cost analysis of an exercise program for older women with respect to social welfare and healthcare costs: a pilot study

2008

The aim of this study was to analyze social welfare and healthcare costs and fall-related healthcare costs after a group-based exercise program. The 10-week exercise program, which started after discharge from the hospital, was designed to improve physical fitness, mood, and functional abilities in frail elderly women. Sixty-eight acutely hospitalized and mobility-impaired women (mean age 83.0, SD 3.9 years) were randomized into either group-based (intervention) or home exercise (control) groups. Information on costs was collected during 1 year after hospital discharge. There were no differences between the intervention and control groups in the mean individual healthcare costs: 4381 euros …

Gerontologymedicine.medical_specialtybiologybusiness.industryhealth care facilities manpower and servicesPhysical fitnessPhysical Therapy Sports Therapy and RehabilitationSocial WelfareEurossocial sciencesbiology.organism_classificationhumanitiesExercise programMoodIntervention (counseling)Health carePhysical therapypopulation characteristicsMedicineOrthopedics and Sports MedicineFrail elderlybusinesshealth care economics and organizationsScandinavian Journal of Medicine &amp; Science in Sports
researchProduct

Retirement age and type as predictors of frailty : a retrospective cohort study of older businessmen

2020

ObjectivesTo study the association between retirement characteristics and frailty in a homogenous population of former business executives.DesignCross-sectional cohort study using data from the Helsinki Businessmen Study.SettingHelsinki, Finland.Participants1324 Caucasian men, born in 1919–1934, who had worked as business executives and managers and of whom 95.9% had retired by the year 2000. Questions on age at and type of retirement, lifestyle and chronic conditions were embedded in questionnaires.Primary and secondary outcome measuresFrailty assessed according to a modified phenotype definition at mean age 73.3 years.ResultsMean age at retirement was 61.3 years (SD 4.3) and 37.1% had ret…

MaleIMPACToccupational & industrial medicineCohort Studies0302 clinical medicineEpidemiologyMedicineEMPLOYMENT1506030212 general & internal medicineSTATE PENSION AGEHEALTH EVIDENCEkohorttitutkimusFinlandAged 80 and overGeriatricsRISKRetirementeducation.field_of_studyFrailtyindustrial medicinepublic healthRMENGeneral MedicineMiddle AgedWORKINGMedicineeläkeikäepidemiologyoccupational &amp1716ikääntyneetMIDLIFECohort studymedicine.medical_specialtyFrail ElderlyPopulation03 medical and health sciencesHumanseducationAgedRetrospective StudiesOccupational and Environmental Medicinebusiness.industrygeriatric medicinePublic healthMORTALITYRetrospective cohort studyCross-Sectional StudiesikääntyminenAgeing3121 General medicine internal medicine and other clinical medicineeläkkeelle siirtyminenTRAJECTORIESbusiness030217 neurology & neurosurgeryRetirement agehauraus-raihnausoireyhtymäDemography
researchProduct

OR-039 Normal-weight obesity and physical fitness in Chinese university students: an overlooked association

2018

Objective The primary aim of this study was to examine the associations of normal weight obesity with physical fitness in Chinese university students. As a secondary aim, we assessed whether possible differences in physical fitness between students classified as NWO and normal weight non-obese (NWNO) were mediated by skeletal muscles mass.&#x0D; Methods A total of 383 students (205 males and 178 females, aged 18–24 years) from two universities volunteered to participate in this study. Body height and weight were measured by standard procedures and body composition was assessed by a bio-impedance device (InBody 720). NWO was defined by a BMI of 18.5 - 23.9 kg/m2 and a body fat percentage of …

Normal weight obesitybusiness.industryBody heightLeisure timePhysical fitnessPhysiologyMedicineHealth riskbusinessFemale studentsBody fat percentageShuttle run testExercise Biochemistry Review
researchProduct

Physical activity history and end-of-life hospital and long-term care

2009

Background: Little is known about the early predictors of need for care in late life. The purpose of this study was to investigate whether physical activity from midlife onward was associated with hospital and long-term care in the last year of life. Methods: We studied a decedent population of 846 persons aged 66–98 years at death, who, on average 5.8 years prior to death, had participated in an interview about their current and earlier physical activity. Data on the use of care in the last year of life are register-based data and complete. Results: Men needed on average 96 days (SD 7.0) and women 138 days (SD 6.2) of inpatient care in the last year of life. Among men, the risk for all-cau…

GerontologyMaleAgingPopulationpitkäaikaishoitoPhysical activityikääntyneet henkilötphysical activitysairaalahoitoRate ratioRisk AssessmentlaitoshoitoAge DistributionRisk FactorsCause of DeathSurveys and QuestionnairesHealth careActivities of Daily LivingConfidence IntervalsOdds RatioMedicineHomes for the AgedHumansMiddle-aged adultProspective StudiesSex DistributioneducationGeriatric AssessmentFinlandAgedAged 80 and overeducation.field_of_studyInpatient carebusiness.industryData CollectionIncidenceLength of StayLong-Term CareHospital careNursing HomesHospitalizationLong-term careagedPhysical FitnessFemaleGeriatrics and Gerontologybusinessfyysinen aktiivisuus
researchProduct

Effects of an individually targeted multicomponent counseling and home-based rehabilitation program on physical activity and mobility in community-dw…

2020

Objectives: The aim of this study is to evaluate the effects of multicomponent rehabilitation on physical activity, sedentary behavior, and mobility in older people recently discharged from hospital. Design: Randomized controlled trial. Setting: Home and community. Participants: Community-dwelling people aged ⩾60 years recovering from a lower limb or back musculoskeletal injury, surgery, or disorder were recruited from local health center hospitals and randomly assigned into an intervention ( n = 59) or a control (standard care, n = 58) group. Intervention: The six-month intervention consisted of a motivational interview, goal attainment process, guidance for safe walking, a progressive hom…

Malemedicine.medical_specialtymedicine.medical_treatmentPhysical activityDirective CounselingPhysical Therapy Sports Therapy and RehabilitationDirective Counselinglaw.inventionistuminen03 medical and health sciences0302 clinical medicineRandomized controlled triallawmobility functionIntervention (counseling)sedentary behaviorliikuntakykyMedicineHumans030212 general & internal medicineMusculoskeletal DiseasesRange of Motion ArticularExerciseinterventionAgedAged 80 and overRehabilitationbusiness.industryRehabilitationagingSedentary behaviorHome Care ServicesPatient DischargeExercise TherapyaccelerometerikääntyminenLower ExtremityPhysical therapyFemaleIndependent LivingSedentary BehaviorbusinessOlder people030217 neurology & neurosurgeryIndependent livingClinical rehabilitation
researchProduct

Does sex hormone-binding globulin cause insulin resistance during pubertal growth?

2019

Background The directional influences between serum sex hormone-binding globulin (SHBG), adiposity and insulin resistance during pubertal growth remain unclear. The aim of this study was to investigate bidirectional associations between SHBG and insulin resistance (HOMA-IR) and adiposity from childhood to early adulthood. Methods Participants were 396 healthy girls measured at baseline (age 11.2 years) and at 1, 2, 4 and 7.5 years. Serum concentrations of estradiol, testosterone and SHBG were determined by ELISA, glucose and insulin by enzymatic photometry, insulin-like growth factor 1 (IGF-1) by time-resolved fluoroimmunoassays, whole-body fat mass by dual-energy X-ray absorptiometry and …

0301 basic medicinemedicine.medical_specialtypubertyGlobulinEndocrinology Diabetes and Metabolismmedicine.medical_treatment030209 endocrinology & metabolismlcsh:Diseases of the endocrine glands. Clinical endocrinology03 medical and health sciences0302 clinical medicineEndocrinologyInsulin resistanceSex hormone-binding globulinInternal medicineinsulin resistanceInternal Medicinemedicinesex hormone-binding globulinkehonkoostumussukupuolihormonitadipositylcsh:RC648-665biologybusiness.industryResearchInsulinmenarcheConfoundinginsuliiniresistenssimurrosikämedicine.diseasetytöt030104 developmental biologyEndocrinologyglobuliinitHomeostatic model assessmentMenarchebiology.proteinbusinesshormones hormone substitutes and hormone antagonistsEarly pubertyEndocrine Connections
researchProduct

Environmental barriers, person-environment fit and mortality among community-dwelling very old people

2013

Background. Environmental barriers are associated with disability-related outcomes in older people but little is known of the effect of environmental barriers on mortality. The aim of this study was to examine whether objectively measured barriers in the outdoor, entrance and indoor environments are associated with mortality among community-dwelling 80- to 89-year-old single-living people. Methods. This longitudinal study is based on a sample of 397 people who were single-living in ordinary housing in Sweden. Participants were interviewed during 2002–2003, and 393 were followed up for mortality until May 15, 2012. Environmental barriers and functional limitations were assessed with the Hous…

Malekuolleisuusmedicine.medical_specialtyLongitudinal studyympäristöFrail Elderlyyksilö-ympäristö yhteensopivuusEnvironmentStairsEnvironmental healthEpidemiologymedicineHumansENABLE AGE-projectMobility LimitationMortalityEnablerProportional Hazards ModelsAged 80 and overSwedenbusiness.industryProportional hazards modelPublic healthPublic Health Environmental and Occupational HealthArchitectural AccessibilityPublic Health Global Health Social Medicine and EpidemiologyHousing for the ElderlyHousing EnablerPerson–environment fitHousingFemaleHousing for the ElderlyBiostatisticsOlder peoplebusinessResearch Article
researchProduct

Midlife work ability and mobility limitation in old age among non-disability and disability retirees - a prospective study

2016

Little is known about the wellbeing and mobility limitation of older disability retirees. Personal and environmental factors, such as time spent in working life, may either exacerbate or mitigate the onset of mobility limitation in general population. We aimed to study perceived midlife work ability as a determinant of self-reported mobility limitation in old age among municipal employees who transitioned into non-disability and disability retirement. METHODS: 4329 participants of the Finnish Longitudinal Study of Municipal Employees (FLAME) had retired during January 1985 and July 2000. They had data on retirement, perceived work ability in 1985, and self-reported mobility limitation (non-…

MaleGerontologyWorkAgingHealth Status0302 clinical medicineInternational Classification of Functioning Disability and HealthInternational Classification of Functioning Disability and HealthSurveys and QuestionnairesEpidemiologytyökykyLongitudinal StudiesMusculoskeletal DiseasesProspective Studies030212 general & internal medicineProspective cohort studyFinlandAged 80 and overRetirementeducation.field_of_studyMental Disorderslcsh:Public aspects of medicineAge FactorsMiddle Aged030210 environmental & occupational healthMobility limitationCardiovascular Diseases8. Economic growthFemaleMunicipal employeesResearch Articlemedicine.medical_specialtyKansanterveystiede ympäristö ja työterveys - Public health care science environmental and occupational healthWork abilityPopulationdisability retirementWork Capacity EvaluationDisability retirementmobility limitation03 medical and health sciencesmedicineHumansDisabled PersonsOccupationseducationkunnan työntekijätAgedbusiness.industryPublic healthagingPublic Health Environmental and Occupational Healthlcsh:RA1-1270Mobility LimitationWork abilityBiostatisticsbusinessBMC Public Health
researchProduct

The Effects of Cold Exposure on Leukocytes, Hormones and Cytokines during Acute Exercise in Humans

2014

The purpose of the study was to examine the effects of exercise on total leukocyte count and subsets, as well as hormone and cytokine responses in a thermoneutral and cold environment, with and without an individualized pre-cooling protocol inducing low-intensity shivering. Nine healthy young men participated in six experimental trials wearing shorts and t-shirts. Participants exercised for 60 min on a treadmill at low (LOW: 50% of peak VO2) and moderate (MOD: 70% VO2peak) exercise intensities in a climatic chamber set at 22°C (NT), and in 0°C (COLD) with and without a pre-exercise low-intensity shivering protocol (SHIV). Core and skin temperature, heart rate and oxygen consumption were col…

MaleMuscle PhysiologyHydrocortisonePhysiologylcsh:MedicineCardiovascular PhysiologyNorepinephrine0302 clinical medicineHeart RateImmune PhysiologySex Hormone-Binding GlobulinMedicine and Health SciencesLeukocytesMedicineTestosteroneInsulin-Like Growth Factor ITreadmilllcsh:Scienceta315MultidisciplinaryThermogenesista314116. Peace & justiceCold shock responseEpinephrineShiveringCytokinesmedicine.symptomEnvironmental HealthResearch ArticleBody Temperature Regulationmedicine.drugAdultmedicine.medical_specialtyEpinephrineleukocytesPhysical ExertionAdrenocorticotropic hormoneYoung Adult03 medical and health sciencesAdrenocorticotropic Hormoneeffects of exerciseInternal medicineHeart rateHumansSports and Exercise MedicineExerciseHydrocortisoneEndocrine Physiologybusiness.industryCold-Shock Responsesytokiinitlcsh:RBiology and Life Sciences030229 sport sciencesMolecular DevelopmenthormonitHealth CareEndocrinologylcsh:QPhysiological Processesbusiness030217 neurology & neurosurgeryDevelopmental BiologyHormonePLoS ONE
researchProduct

Feasibility and psychometric properties of the Finnish version of the measure of processes of care for adults

2018

To assess the psychometric properties and feasibility of the Finnish translation of the measure of processes of care for adults (MPOC-A) when used in an inpatient rehabilitation setting.A feasibility study.Inpatient rehabilitation settings.A total of 858 people with severe neurological disabilities, musculoskeletal problems, and mental disorders were recruited to the study.The MPOC-A questionnaire is a self-administered questionnaire consisting of 34 items in five-factorial domains. The construct validity of the translated questionnaire was evaluated using confirmatory factor analysis. To compare the fit of the model to the fit of the independent null-model Comparative Fit Index was used. I…

AdultMalepsychometricsGerontologyvuxna (myndiga)PsychometricsMeasure (physics)Physical Therapy Sports Therapy and RehabilitationklientarbetepotilaslähtöisyysYoung Adult03 medical and health sciences0302 clinical medicineSurveys and Questionnairesadultsmeasures (measurement)HumansTranslationsMusculoskeletal Diseases030212 general & internal medicinemetriklääkinnällinen kuntoutusFinlandmeasures of processes of care for adultsAgedta316Aged 80 and overInpatientsMental Disorders030503 health policy & servicesProcess Assessment Health CareRehabilitationReproducibility of Resultsta3141customer orientationNeuromuscular DiseasesMiddle AgedProcess of carepsykometriikkaFeasibility StudiesFemaleFactor Analysis Statistical0305 other medical sciencePsychologyarviointiclient-centeredInpatient rehabilitationClinical rehabilitation
researchProduct

Hearing and Quality of Life Among Community-Dwelling Older Adults

2018

Objectives Hearing loss is a common health concern in older people, and the prevalence of hearing loss increases with aging. Poor hearing may cause difficulties in everyday life situations and reduce quality of life (QoL). The aim of this study was to assess the associations between different domains of QoL (physical, psychological, social, and environmental), perceived hearing difficulties in various everyday situations, and audiometrically measured hearing level among community-dwelling older adults. Method Cross-sectional analysis of 76- to 91-year-old community-dwelling adults. Data on QoL (WHO Quality of Life Assessment short version) and perceived hearing difficulties were gathered vi…

Malemedicine.medical_specialtySocial PsychologyCross-sectional studyHearing lossSpeech hearingelämänlaatuAudiologylife space03 medical and health sciences0302 clinical medicineAudiometryQuality of lifeSurveys and Questionnairesotorhinolaryngologic diseasesmedicineHumans030212 general & internal medicineHearing LossEveryday lifeAgedAged 80 and overSocioemotional selectivity theorymedicine.diagnostic_testagingta3141ta3142cohortkuulohumanitiesClinical PsychologyCross-Sectional Studiesikääntyminenquality of lifeHearing levelhearingFemaleIndependent LivingGeriatrics and Gerontologymedicine.symptomAudiometryPsychologyGerontology030217 neurology & neurosurgeryThe Journals of Gerontology: Series B
researchProduct

Perceived Opportunities for Physical Activity and Willingness to Be More Active in Older Adults with Different Physical Activity Levels

2021

This study examined equity in physical activity (PA) by investigating whether perceived opportunity for PA was associated with willingness to be more active. Among community residents (75, 80, or 85 years old, n = 962) perceived opportunity for PA (poor and good), willingness to be more active (not at all, a bit, and a lot), and level of PA (low, moderate, and high) were assessed via questionnaires. Multinomial logistic regression showed that physical activity moderated the association between poor opportunity and willingness to increase PA. Among those with moderate PA, poor opportunity for PA increased the odds of willingness to be a lot more active (multinomial odds ratio, mOR 3.90, 95% …

tarpeetHealth Toxicology and Mutagenesisfyysinen toimintakykyPhysical activityCommunity residentPhysical functionArticleUnmet needsOdds03 medical and health sciencesequity0302 clinical medicinephysical functionSurveys and QuestionnairesMedicine030212 general & internal medicine10. No inequalityMultinomial logistic regressionexercisekuntoliikuntabusiness.industryagingPublic Health Environmental and Occupational HealthR030229 sport sciencesOdds ratioConfidence intervalunmet needMedicinebusinessfyysinen aktiivisuusikääntyneetDemographyInternational Journal of Environmental Research and Public Health
researchProduct

Effects of a multicomponent home-based physical rehabilitation program on mobility recovery after hip fracture: a randomized controlled trial.

2013

To investigate whether a home-based rehabilitation program for community-dwelling older people with recent hip fracture is more effective than standard care in improving mobility recovery and reducing disability.Randomized, controlled, parallel-group trial.Rehabilitation in participants' homes; measurements in university-based laboratory and local hospital.Clinical population of community-dwelling men and women (aged 60+) recovering from hip fracture. Participants were randomly assigned into control (n = 41) or intervention (n = 40) groups on average 42 ± 23 days after discharge home.A yearlong multicomponent home-based rehabilitation aimed at promoting mobility recovery and physical functi…

Malemedicine.medical_specialtymedicine.medical_treatmentPopulationlaw.inventionPhysical medicine and rehabilitationStairsRandomized controlled triallawIntervention (counseling)Outcome Assessment Health CaremedicineHumansMobility LimitationeducationGeneral NursingAgedAged 80 and overeducation.field_of_studyHip fractureRehabilitationbusiness.industryHip FracturesHealth PolicyRepeated measures designta3141General Medicinemedicine.diseaseHome Care ServicesBerg Balance ScalePhysical therapyFemaleGeriatrics and GerontologybusinessFollow-Up StudiesJournal of the American Medical Directors Association
researchProduct

Hearing in Real-Life Environments (HERE) : Structure and Reliability of a Questionnaire on Perceived Hearing for Older Adults

2019

Supplemental Digital Content is available in the text.

MaleAgingIntraclass correlationHealth StatusvanhuksetAudiologyIntelligibility (communication)01 natural sciencesspeech perception0302 clinical medicineHearingSurveys and Questionnaires030223 otorhinolaryngology010301 acousticshuonokuuloisuusAged 80 and overSpeech perceptionikäkuulota3142Social ParticipationkuuloHearing levelTest scoreComputingMethodologies_DOCUMENTANDTEXTPROCESSINGAuditory PerceptionFemalemedicine.symptomPsychologyikääntyneetResearch Articlemedicine.medical_specialtySpeech perceptionHearing loss03 medical and health sciencesSpeech and HearingCronbach's alpha0103 physical sciencesmedicineotorhinolaryngologic diseasesHumansSound LocalizationHearing Lossquestionnaire validationOrientation SpatialAgedagingReproducibility of ResultsQuestionnaire validationta3125ikääntyminenOtorhinolaryngologyhearingStandardized coefficientQuality of LifeSelf ReportFactor Analysis StatisticalCOSMIN criteria
researchProduct

Midlife Cardiovascular Status and Old Age Physical Functioning Trajectories in Older Businessmen

2019

Objectives The associations between cardiovascular disease (CVD) risk and later physical functioning have been observed, but only a few studies with follow-up into old age are available. We investigated the association between cardiovascular status in midlife and physical functioning trajectories in old age. Design Prospective cohort study. Setting Helsinki Businessmen Study. Participants We studied white men born between 1919 and 1934 in the Helsinki Businessmen Study (HBS, initial n = 3490). Measurements Three CVD status groups were formed based on clinical measurements carried out in 1974: signs of CVD (diagnosed clinically or with changes in ECG, chronic disease present or used medicati…

MaleAgingCvd riskHealth Statuseducationfyysinen toimintakykyDisease030204 cardiovascular system & hematologyCompeting risksHealthy AgingDisability Evaluation03 medical and health sciences0302 clinical medicinePhysical functioningRisk FactorsSurveys and QuestionnairesGrowth mixture modelingphysical functioningtrajectoriesHumansMedicineProspective Studies030212 general & internal medicineHealthy agingProspective cohort studyExercisegrowth mixture modelFinlandAgedCARDIOVASCULAR HEALTHbusiness.industrycardiovascular healthennusteetMiddle Aged3. Good healthikääntyminenStandard errorhealthy aginglife course epidemiologyCardiovascular Diseases3121 General medicine internal medicine and other clinical medicinesydän- ja verisuonitauditphysical functioning trajectoriesChronic disease presentGeriatrics and GerontologybusinessDemographyJournal of the American Geriatrics Society
researchProduct

Associations of neuroticism with falls in older adults : do psychological factors mediate the association?

2020

OBJECTIVES Neuroticism predicts falls in older people. In addition, concern about falling and depressive symptoms are associated with fall risk. This study examined whether concern about falling and depressive symptoms mediate the association between neuroticism and falls. METHOD Cross-sectional data on 314 community-dwelling people aged 70–85 years were utilized. Neuroticism was assessed with a short modified form of the Eysenck Personality Inventory. Indoor and outdoor falls during the past year were self-reported. Concern about falling was assessed with the Falls Efficacy Scale-International and depressive symptoms with the Geriatric Depression Scale-15. Path modeling was used to examine…

psykologiset tekijätCross-sectional studymedia_common.quotation_subjectpoikittaistutkimuscross-sectional studiesFalls in older adults03 medical and health sciences0302 clinical medicinemental disordersHumansMedicinePersonalityrisk factorspelkoAssociation (psychology)Depressive symptomsAgedmedia_commonNeuroticismkaatuminen030214 geriatricsbusiness.industrypersoonallisuuden piirteetFearFall riskriskitekijäthuolestuneisuusNeuroticismPsychiatry and Mental healthagedCross-Sectional StudiesFalling (accident)personalityfearIndependent Livingaccidental fallsGeriatrics and GerontologyPshychiatric Mental Healthmedicine.symptombusinessGerontology030217 neurology & neurosurgeryikääntyneetClinical psychology
researchProduct

The Scales of Psychological Well-Being – a validation, usability and test–retest study among community-dwelling older people in Finland

2020

Objectives: To validate the Finnish version of the 42-item Scales of Psychological Well-Being among community-dwelling older people. The study also examined the test–retest reliability and usability, i.e. user experience, of the scales in this age group. Method: The 42-item version of the SPWB was administered as part of a face-to-face interview among 968 men and women aged 75, 80 or 85 years. The subsample for test–retest analyses comprised 42 participants, who in addition to 11 interviewers also answered questions concerning the usability of the scales. Exploratory and confirmatory factor analyses, Cronbach’s alpha coefficients, Pearson and intra-class correlation coefficients, and Kendal…

psychometricsMaleGerontologyhyvinvointi (terveydellinen)PsychometricsPsychometricseudaimonic well-beingbehavioral disciplines and activities03 medical and health sciences0302 clinical medicineQuality of life (healthcare)Surveys and QuestionnairesHumansFinlandReliability (statistics)AgedAged 80 and over030214 geriatricsbusiness.industryagingReproducibility of ResultsUsabilityTest (assessment)psykometriikkaPsychiatry and Mental healthikääntyminenPsychological well-beingQuality of LifeFemaleIndependent LivingGeriatrics and GerontologyPshychiatric Mental HealthFactor Analysis StatisticalOlder peoplebusinessPsychologyGerontology030217 neurology & neurosurgeryIndependent livingAging &amp; Mental Health
researchProduct

The effectiveness of cochlear implantation on performance-based and patient-reported outcome measures in Finnish recipients

2021

Understanding speech is essential for adequate social interaction, and its functioning affects health, wellbeing, and quality of life (QoL). Untreated hearing loss (HL) is associated with reduced social activity, depression and cognitive decline. Severe and profound HL is routinely rehabilitated with cochlear implantation. The success of treatment is mostly assessed by performance-based outcome measures such as speech perception. The ultimate goal of cochlear implantation, however, is to improve the patient’s QoL. Therefore, patient-reported outcomes measures (PROMs) would be clinically valuable as they assess subjective benefits and overall effectiveness of treatment. The aim of this study…

NCIQoutcome measuresQualityof life (QOL)hoitotuloksetGeneral NeuroscienceQuality of Lifeotorhinolaryngologic diseasescochlear implantSpeech PerceptionsisäkorvaistutteetelämänlaatuSSQ
researchProduct

Muscle and bone mass in middle‐aged women : role of menopausal status and physical activity

2020

Background. Women experience drastic hormonal changes during midlife due to the menopausal transition. Menopausal hormonal changes are known to lead to bone loss and potentially also to loss of lean mass. The loss of muscle and bone tissue coincide due to the functional relationship and interaction between these tissues. If and how physical activity counteracts deterioration in muscle and bone during the menopausal transition remains partly unresolved. This study investigated differences between premenopausal, early perimenopausal, late perimenopausal, and postmenopausal women in appendicular lean mass (ALM), appendicular lean mass index (ALMI), femoral neck bone mineral density (BMD) and T…

Sarcopeniamidlifesukupuolihormonitnaisetlcsh:Diseases of the musculoskeletal systemvaihdevuodetosteoporoosiluukeski-ikäMidlifelcsh:Human anatomyosteoporosissex hormoneslcsh:QM1-695sarcopeniafemalelihasmassaOsteoporosisFemaleSex hormoneslcsh:RC925-935lihassurkastumasairaudet
researchProduct

Normal-weight obesity and cardiometabolic risk: A 7-year longitudinal study in girls from prepuberty to early adulthood

2017

Objective To study whether normal-weight obesity in childhood is associated with increased cardiometabolic risk in early adulthood. Methods This study assessed data for 236 girls followed from prepuberty to early adulthood. Growth chart data were obtained from birth to 18 years. Body composition was assessed by dual-energy x-ray absorptiometry and cardiometabolic risk by calculating continuous clustered risk score (at ages 11, 14, and 18). The association of body weight status with cardiometabolic risk from childhood to early adulthood was examined. Results Subjects with normal-weight obesity were virtually indistinguishable from their normal-weight lean peers in terms of relative body weig…

medicine.medical_specialtyGrowth chartLongitudinal studyPediatricsNutrition and DieteticsFramingham Risk Scorebusiness.industryEndocrinology Diabetes and MetabolismMedicine (miscellaneous)030209 endocrinology & metabolismmedicine.diseaseObesityBody fat percentage03 medical and health sciencesNormal weight obesity0302 clinical medicineEndocrinologyEndocrinologyPrepubertyInternal medicinemedicine030212 general & internal medicinebusinessBody mass indexObesity
researchProduct

Sport disciplines, types of sports, and waist circumference in young adulthood – a population-based twin study

2017

Purpose: The benefits of physical activity (PA) in preventing abdominal obesity are well recognized, but the role of different sport disciplines remains open. We aimed, therefore, to investigate how participation in different sport disciplines, and the number and types of sports engaged in are associated with waist circumference (WC) in young adulthood. Methods: This population-based cohort study comprised 4027 Finnish twin individuals (1874 men), with a mean age of 34 y (32-37), who answered a survey, including self-measured WC. We extracted the number and identified the types (aerobic, power, and mixed) of the different sport disciplines respondents reported participating in. Results: The…

MaleliikuntaCohort Studies0302 clinical medicineOrthopedics and Sports Medicine030212 general & internal medicinetwin study315 Sport and fitness sciencesYoung adultta315Abdominal obesityRISKeducation.field_of_studyta3141General Medicinewaist circumference3142 Public health care science environmental and occupational healthsport disciplinesWEIGHT-GAINVISCERAL FATADOLESCENCEFemaleHEALTHmedicine.symptomfyysinen aktiivisuusSportsCohort studyAdultCOUNTRIESmedicine.medical_specialtyWaistDizygotic twinPopulationEXERCISE030209 endocrinology & metabolismPhysical Therapy Sports Therapy and Rehabilitationabdominal obesityTIME PHYSICAL-ACTIVITY03 medical and health sciencesmedicineHumanseducationkaksostutkimusPhysical activitybusiness.industryTwin studyBODY-MASS INDEXPhysical therapybusinesshuman activitiesBody mass indexDemographyEuropean Journal of Sport Science
researchProduct

Pathways from childhood socioemotional characteristics and cognitive skills to midlife health behaviours.

2022

Objective: This longitudinal study investigated the pathways from childhood socioemotional characteristics and cognitive skills to health behaviours in midlife. Methods: Participants in the Jyväskylä Longitudinal Study of Personality and Social Development (JYLS) were followed from age 8 (n=369) to age 50 (n=271). Outcomes included physical activity, smoking, alcohol consumption and body mass index (BMI) assessed at ages 36, 42 and 50. Predictors were socioemotional characteristics (behavioural activity, negative emotionality, and well-controlled behaviour) and parents’ occupational status collected at age 8, cognitive skills (school success at age 14 and the highest education at age 27) an…

kognitiiviset taidoteducationelintavatpersoonallisuuden kehityskeski-ikäPublic Health Environmental and Occupational HealthhealthpitkittäistutkimusGeneral MedicineGeneral Chemistrylapsuuselämänkaaripersonalityterveyskäyttäytyminenmiddle agedApplied PsychologychildhoodPsychologyhealth
researchProduct

Effects of physical and cognitive training on gait speed and cognition in older adults: A randomized controlled trial

2021

Gait speed is a measure of health and functioning. Physical and cognitive determinants of gait are amenable to interventions, but best practices remain unclear. We investigated the effects of a 12-month physical and cognitive training (PTCT) on gait speed, dual-task cost in gait speed, and executive functions (EFs) compared with physical training (PT) (ISRCTN52388040). Community-dwelling older adults, who did not meet physical activity recommendations, were recruited (n = 314). PT included supervised walking/balance (once weekly) and resistance/balance training (once weekly), home exercises (2-3 times weekly), and moderate aerobic activity 150 min/week in bouts of >10 min. PTCT included the…

Malemedicine.medical_specialtyTime FactorsComputer User TrainingWalk TestPhysical Therapy Sports Therapy and RehabilitationWalking030204 cardiovascular system & hematologylaw.inventionExecutive Function03 medical and health sciences0302 clinical medicinePhysical medicine and rehabilitationRandomized controlled triallawHumansMedicineAerobic exerciseOrthopedics and Sports MedicinePostural BalanceAgedBalance (ability)Aged 80 and overTrail Making Testbusiness.industryResistance TrainingCognition030229 sport sciencesExecutive functionsGaitCognitive trainingExercise TherapyWalking SpeedStroop TestFemaleIndependent Livingbusinesshuman activitiesStroop effectScandinavian Journal of Medicine &amp; Science in Sports
researchProduct

Recovery of Lower Extremity Performance After Hip Fracture Depends on Prefracture and Postdischarge Mobility : A Subgroup Analysis of a Randomized Re…

2016

Malemedicine.medical_specialtymedicine.medical_treatmentSubgroup analysisrehabilitation03 medical and health sciences0302 clinical medicinePhysical medicine and rehabilitationActivities of Daily LivingmedicineHumans030212 general & internal medicineAgedRandomized Controlled Trials as TopicAged 80 and overHip fractureRehabilitationHip Fracturesbusiness.industryta3141Recovery of FunctionMiddle Agedmedicine.diseasemobilityhip fracturePhysical therapylower extremityFemaleGeriatrics and Gerontologybusiness030217 neurology & neurosurgeryperformanceJournal of the American Geriatrics Society
researchProduct

Inverse Effects of Midlife Occupational and Leisure Time Physical Activity on Mobility Limitation in Old Age-A 28-Year Prospective Follow-Up Study

2014

Objectives: To evaluate in a sample of initially middle-aged municipal employees whether leisure time (LPA) or occupational physical activity (OPA) was associated with mobility limitation (ML) in old age. Design: Prospective population-based follow-up. Setting: Municipalities in Finland. Participants: Public sector employees from the Finnish Longitudinal Study on Municipal Employees (FLAME) initially aged 44 to 58 (N = 5,200). Measurements: Baseline data were collected in 1981, including LPA (average exercise within previous year: inactive (no exercise), moderate (some form of exercise ?1 time per week), vigorous (brisk exercise ?1 time per week)) and OPA (usual activities at work within pr…

AdultMaleLongitudinal studymedicine.medical_specialtyHealth BehaviorPopulationphysical activityMotor Activity030204 cardiovascular system & hematologySittingLower riskOccupational safety and healthmobility limitation03 medical and health sciencessymbols.namesakeLeisure Activities0302 clinical medicineRisk FactorsSurveys and QuestionnairesHumanslongitudinal studiesMedicineProspective Studies030212 general & internal medicinePoisson regressionProspective cohort studyeducationta512ta314occupational classFinlandOccupational Healtheducation.field_of_studybusiness.industryagingta3141ta3142Middle AgedConfidence intervalPhysical therapysymbolsFemaleGeriatrics and GerontologybusinessFollow-Up StudiesForecastingJournal of the American Geriatrics Society
researchProduct

Effects of Physical and Cognitive Training on Falls and Concern About Falling in Older Adults : Results From a Randomized Controlled Trial

2022

Abstract Background The aim of this study is to investigate whether combined cognitive and physical training provides additional benefits to fall prevention when compared with physical training (PT) alone in older adults. Methods This is a prespecified secondary analysis of a single-blind, randomized controlled trial involving community-dwelling men and women aged 70–85 years who did not meet the physical activity guidelines. The participants were randomized into combined physical and cognitive training (PTCT, n = 155) and PT (n = 159) groups. PT included supervised and home-based physical exercises following the physical activity recommendations. PTCT included PT and computer-based cogniti…

MaleAgingkaatuminentoiminnanohjaus (psykologia)kuntoliikuntaFollow-upInterventioninterventiotutkimusExercise TherapyExecutive functionsCognitionHumansharjoituksetFemaleSingle-Blind MethodGerontologi medicinsk/hälsovetenskaplig inriktningseurantatutkimusIndependent LivingFall preventionGerontology specialising in Medical and Health SciencesGeriatrics and GerontologyExerciseikääntyneetAged
researchProduct

Counselling for physical activity, life-space mobility and falls prevention in old age (COSMOS): protocol of a randomised controlled trial.

2019

IntroductionThe most promising way to promote active life years in old age is to promote regular participation in physical activity (PA). Maintaining lower extremity muscle function with good balance has been associated with fewer falls and the need of help from others. This article describes the design and intervention of a randomised controlled trial (RCT) investigating the effectiveness of a health and PA counselling programme on life-space mobility and falls rates in community-dwelling older adults at the Health Kiosk and/or Service Centre.Methods and analysisCommunity-dwelling men and women (n=450) aged 65 years and over with early phase mobility limitation will be recruited to a 24-mo…

CounselingMalephysical activityFear of fallinglaw.inventionolder people0302 clinical medicineRandomized controlled triallawActivities of Daily LivingPreventive Health ServicesfallsProtocolMedicine030212 general & internal medicine1506Postural BalanceRandomized Controlled Trials as TopickaatuminenSisätaudit - Internal medicineCognitionGeneral Medicine3. Good healthcounsellingFemaleIndependent LivingPublic Healthmedicine.symptomikääntyneetfyysinen aktiivisuusmedicine.medical_specialtylife-space mobilityterveyden edistäminen03 medical and health sciencesterveysneuvontaQuality of life (healthcare)Intervention (counseling)liikuntakykyHumans1724Mobility LimitationExerciseBalance (ability)AgedProtocol (science)business.industryResistance TrainingMoodPhysical therapyQuality of LifeAccidental Fallsbusiness030217 neurology & neurosurgeryProgram EvaluationBMJ open
researchProduct

Structure of self-rated health among the oldest old: Analyses in the total population and those living with dementia

2020

No previous study has explored the structure of self-rated health (SRH), a measure holding strong predictive value for future health events, in the oldest old or in individuals with dementia. The aim was to construct a structural equation model of SRH for oldest old in general and for oldest old with dementia, and to explore direct and indirect associations between health-related factors and SRH. Cross-sectional data from the Vitality 90+, a population-based study in the city of Tampere, Finland, was used. Data were gathered by a mailed questionnaire in 2014. Altogether 1299 nonagenarians, of which 408 had self-reported dementia or cognitive decline, were included. Structural equation model…

cognitionkognitioeducationstructural equation modellingperceived healthSelf-assessed healthkoettu terveysArticleCognitionlcsh:Social sciences (General)FinlandPerceived healthlcsh:Public aspects of medicinelcsh:RA1-1270self-assessed health3142 Public health care science environmental and occupational health3141 Health care sciencebody regions5142 Social policynonagenariansStructural equation modellingNonagenarianslcsh:H1-99316 NursingmuistisairaatikääntyneetSSM - Population Health
researchProduct

Perceived Burden among Spouse, Adult Child and Parent Caregivers

2018

Aims To identify what factors are associated with the caregiver burden of spouse caregivers, adult child caregivers, and parent caregivers. Background Caregivers often feel stressed and perceive caregiving as a burden. The caregiver burden has been little studied from the perspective of the personal relationship between caregiver and care recipient. Design Cross-sectional study. Methods A random sample of 4,000 caregivers in Finland was drawn in 2014 and those who remained either spouse, adult child, or parent caregivers at data collection were included in the analysis (N = 1,062). Data collection included recipients' characteristics. Caregivers' perceived burden was measured using the Care…

GerontologyMaleParents0302 clinical medicineCost of IllnessomaishoitajatnursingSurveys and QuestionnairesNursing Interventions ClassificationMedicine030212 general & internal medicinenursing (work)General NursingFinlandmedia_commonta316Aged 80 and overDaughteradult child caregiverDepressionPersonal relationshipCognitionCaregiver burdenta3142Middle AgedSpouse Caregiversspouse caregiverCaregiversSpouseAdult ChildrenFemaleAdultmedia_common.quotation_subjectcaregivingparent caregivergeneral linear models03 medical and health sciencesYoung AdultHumansomaishoitoSpousesAgedperceived caregiver burdenbusiness.industrySocial SupportCross-Sectional Studiestyön kuormittavuusPerceptionbusinessOlder peopleCognition Disorderskoettu hyvinvointi030217 neurology & neurosurgeryStress PsychologicalJournal of Advanced Nursing
researchProduct

Effects of a Home‐Based Physical Rehabilitation Program on Tibial Bone Structure, Density, and Strength After Hip Fracture: A Secondary Analysis of a…

2019

Abstract Weight‐bearing physical activity may decrease or prevent bone deterioration after hip fracture. This study investigated the effects of a home‐based physical rehabilitation program on tibial bone traits in older hip fracture patients. A population‐based clinical sample of men and women operated for hip fracture (mean age 80 years, 78% women) was randomly assigned into an intervention (n = 40) and a standard care control group (n = 41) on average 10 weeks postfracture. The intervention group participated in a 12‐month home‐based rehabilitation intervention, including evaluation and modification of environmental hazards, guidance for safe walking, nonpharmacological pain management, m…

Orthopedic surgeryluustoINJURY/FRACTURE HEALINGexerciseagingluuEXERCISEDiseases of the musculoskeletal systemOriginal ArticlesliikuntaAGINGikääntyminenmurtumatRC925-935BONE QCT/μCTkliiniset kokeetOriginal ArticleRD701-811injury/fracture healingCLINICAL TRIALSJBMR Plus
researchProduct

Physical activity after a hip fracture : effect of a multicomponent home-based rehabilitation program - a secondary analysis of a randomized controll…

2017

Objectives To investigate the effect of a yearlong multicomponent rehabilitation program on the level of physical activity (PA) and the maintenance of the level of PA over 1-year follow-up among older people recovering from a recent hip fracture. Design Secondary analysis of a randomized, controlled, parallel-group trial. Setting Home-based rehabilitation; measurements in university laboratory. Participants Community-dwelling people (N=81) aged ≥60 years recovering from a hip fracture. Participants were randomly assigned to an intervention (n=40) or a control (n=41) group, on average, 42±23 days after discharge from the hospital. Intervention A yearlong intervention included evaluation and …

hip fracturephysical activitykuntoutuslonkkamurtumatfyysinen aktiivisuus
researchProduct

Inter‐individual variation of the urinary steroid profiles in Swedish and Norwegian athletes

2020

The steroidal module of the Athlete Biological Passport (ABP) aims to detect doping with endogenous steroids, e.g. testosterone (T), by longitudinally monitoring several biomarkers. These biomarkers are ratios combined of urinary concentrations of testosterone and metabolically related steroids. However, it is evident after five years of monitoring steroid passports, that there are large variations in the steroid ratios complicating its interpretation. In this study, we used over 11 000 urinary steroid profiles from Swedish and Norwegian athletes to determine both the inter‐ and intra‐individual variations of all steroids and ratios in the steroidal passport. Furthermore, we investigated if…

urinary steroidsbiomarkkeritdopingprofiilit (tieto)biologinen passitestausmenetelmätdoping in sportsathlete biological passportsteroid profilevaihteluconfounding factorssteroiditvirtsaurheilijat
researchProduct

Supplemental_figure_2 – Supplemental material for Effects of an individually targeted multicomponent counseling and home-based rehabilitation program…

2020

Supplemental material, Supplemental_figure_2 for Effects of an individually targeted multicomponent counseling and home-based rehabilitation program on physical activity and mobility in community-dwelling older people after discharge from hospital: a randomized controlled trial by Katri M Turunen, Laura Aaltonen-Määttä, Timo Törmäkangas, Timo Rantalainen, Erja Portegijs, Sirkka Keikkala, Marja-Liisa Kinnunen, Taija Finni, Sarianna Sipilä and Riku Nikander in Clinical Rehabilitation

FOS: Clinical medicine110604 Sports MedicineFOS: Health sciences110904 Neurology and Neuromuscular Diseases110314 Orthopaedics
researchProduct

The effects of a physical and cognitive training intervention vs. physical training alone on older adults' physical activity : A randomized controlle…

2021

BackgroundExecutive functions underlie self-regulation and are thus important for physical activity and adaptation to new situations. The aim was to investigate, if yearlong physical and cognitive training (PTCT) had greater effects on physical activity among older adults than physical training (PT) alone, and if executive functions predicted physical activity at baseline, after six (6m) and twelve months (12m) of the interventions, one-year post-intervention follow-up and an extended follow-up during COVID-19 lockdown.MethodsData from a single-blinded, parallel-group randomized controlled trial (PASSWORD-study, ISRCTN52388040) were utilized. Participants were 70-85 years old community-dwel…

MaleViral DiseasesPhysiologyEpidemiologySocial SciencesWalkingExecutive FunctionMedical ConditionsElderlyMedicine and Health SciencesPROGRAMPsychologyPublic and Occupational HealthSingle-Blind MethodGerontologi medicinsk/hälsovetenskaplig inriktningApplied PsychologyVirus TestingAged 80 and overkuntoliikuntaQEXECUTIVE FUNCTIONSRPublic Health Global Health Social Medicine and EpidemiologyinterventiotutkimusSports ScienceMultidisciplinary SciencesInfectious DiseasesTreatment OutcomeMedicineScience & Technology - Other TopicsFemaleikääntyneetfyysinen aktiivisuusResearch Articletoiminnanohjaus (psykologia)harjoitteetGeneral Science & TechnologyScienceEXERCISEADHERENCEAGEDiagnostic MedicinePEOPLEAdultsHumansGerontology specialising in Medical and Health SciencesSports and Exercise MedicinePandemicsAgedBehaviorScience & TechnologyTrail Making TestBiological LocomotionSARS-CoV-2DISABILITYKlinisk medicinBiology and Life SciencesCOVID-19Covid 19Physical ActivityPERFORMANCETillämpad psykologiEFFICACYLIFEFolkhälsovetenskap global hälsa socialmedicin och epidemiologiLogistic ModelsAge GroupsPhysical FitnessPeople and PlacesPopulation GroupingsClinical MedicineFollow-Up Studies
researchProduct

Participant characteristics associated with the effects of a physical and cognitive training program on executive functions

2022

Background: Physical and cognitive interventions have been shown to induce positive effects on older adults’ executive functioning. However, since participants with different background characteristics may respond differently to such interventions, we investigated whether training effects on executive functions were associated with sex, training compliance, and age. We also investigated if change in global cognition was associated with physical and cognitive training intervention-induced changes in executive functions. Methods: Exploratory data from a randomized controlled trial were analyzed. Participants were 70–85-year-old men and women who received a 12-month physical (PT) or physical a…

cognitionkognitiiviset taidottoiminnanohjaus (psykologia)human experimentphysical trainingmaletoimintakykyharjoittelucontrolled studyGerontologi medicinsk/hälsovetenskaplig inriktninghumanGerontology specialising in Medical and Health Sciencesolder adultstrail making testtrainingarticletraining responseinterventiotutkimusexecutive functions3141 Health care scienceagedfemaleexecutive functionexploratory researchrandomized controlled trialphysical and cognitive trainingikääntyneet
researchProduct

Kansallinen kyselytutkimus englannin kielestä Suomessa : käyttö, merkitys ja asenteet

2009

suomen kieliosaaminenkielenkäyttöSuomikyselytutkimussuomalaisetenglannin kielisosiolingvistiikka
researchProduct

Normal weight obesity and physical fitness in Chinese university students: an overlooked association

2018

Background: The primary aim of this study was to examine the associations of normal weight obesity (NWO) with physical fitness in Chinese university students. As a secondary aim, we assessed whether possible differences in physical fitness between students classified as NWO and normal weight non-obese (NWNO) were mediated by skeletal muscles mass. Methods: A total of 383 students (205 males and 178 females, aged 18–24 years) from two universities volunteered to participate in this study. Body height and weight were measured by standard procedures and body composition was assessed by bio-impedance analysis (InBody 720). NWO was defined by a BMI of 18.5–23.9 kg/m2 and a body fat percentage of…

fyysinen kuntolihasmassakansanterveysrasvaprosenttibody-mass indexphysical activityskeletal muscle masspainoindeksifyysinen aktiivisuuskehonkoostumus
researchProduct

Leisure-time physical activity and DNA methylation age : a twin study

2019

Background: Epigenetic clocks may increase our understanding on human aging and how genetic and environmental factors regulate an individual aging process. One of the most promising clocks is Horvath’s DNA methylation (DNAm) age. Age acceleration, i.e., discrepancy between DNAm age and chronological age, tells us whether the person is biologically young or old compared to his/her chronological age. Several environmental and lifestyle factors have been shown to affect life span. We investigated genetic and environmental predictors of DNAm age in young and older monozygotic (MZ) and dizygotic (DZ) twins with a focus on leisure time physical activity. Results: Quantitative genetic modeling rev…

twin designepigenetiikkaphysical activitymethylationkvantitatiivinen genetiikkaepigenetic clockfyysinen aktiivisuus
researchProduct

Testing a physical education-delivered autonomy supportive intervention to promote leisure-time physical activity in lower secondary school students:…

2020

© 2020 The Author(s). Background: Inadequate physical activity in young people is associated with several physical and mental health concerns. Physical education (PE) is a potentially viable existing network for promoting physical activity in this population. However, little research has been conducted on whether PE teachers can influence students' engagement in leisure-time physical activity. The present study therefore examined the efficacy of an intervention aimed at increasing PE teachers' autonomy support on students' leisure-time physical activity (the PETALS trial). The intervention was guided by the trans-contextual model (TCM) explaining the processes by which PE teachers' provisio…

itsemäärääminenyläkoululaisetphysical activityACTIVITY QUESTIONNAIRECHILDRENliikuntaCardiovascularSPORTkoululiikuntaFormerly Health & Social SciencesAutonomy supportmotivaatioPhysical Education and TrainingSchoolslcsh:Public aspects of medicineautonomous motivation3142 Public health care science environmental and occupational healthautonomy supportphysical educationYOUTHPublic Health and Health ServicesFemalePublic HealthPAST BEHAVIORfyysinen aktiivisuusResearch ArticleAdultAdolescentTEACHERSHEALTH BEHAVIORomatoimisuusTRANS-CONTEXTUAL MODELLeisure ActivitiesClinical ResearchBehavioral and Social SciencePhysical educationHumansStudentsExerciseMotivationtrans-contextual modelPhysical activityPreventionPublic Health Environmental and Occupational HealthSELF-DETERMINATION THEORYlcsh:RA1-1270Autonomous motivationterveyskäyttäytyminenPersonal AutonomyBMC public health
researchProduct

Genetic and Environmental Effects on Telomere Length and Lung Function : A Twin Study

2017

Background The purpose of the study was to estimate the heritability of leukocyte telomere length (LTL) and lung function and to examine whether LTL and lung function share genetic or environmental effects in common. Methods 386 monozygotic and dizygotic Finnish twin sisters (age 68.4±3.4 years) were included. Relative LTL was determined from peripheral blood DNA by qPCR. Lung function measures of FEV1, FVC, FEV1/FVC, and PEF were derived from spirometry. Genetic modeling was performed with MPlus statistical software. Results Univariate analysis revealed that in LTL, 62% (95% confidence interval 50–72) of the variance was explained by additive genetic and 38% (28–50) by unique environmental…

genetic modelingtelomeeritrespiratory systemspirometriarespiratory tract diseases
researchProduct

Associations between muscle strength, spirometric pulmonary function and mobility in healthy older adults

2014

Background: Pathological obstruction in lungs leads to severe decreases in muscle strength and mobility in patients suffering from chronic obstructive pulmonary disease. The purpose of this study was to investigate the interdependency between muscle strength, spirometric pulmonary functions and mobility outcomes in healthy older men and women, where skeletal muscle and pulmonary function decline without interference of overt disease. Methods: 135 69 to 81‐yr‐old participants were recruited into the cross‐sectional study, which was performed as a part of European study MyoAge. Full, partial and no mediation models were constructed to assess the interdependency between muscle strength (handgr…

lower extremity muscle powertimed up and go testhandgrip strengthsix-minute walk testspirometriaspirometric pulmonary functionknee extension torque
researchProduct

Body Weight, Physical Activity, and Risk of Cancer in Lynch Syndrome

2021

Simple Summary Lifestyle modifies cancer risk in the general public. How lifestyle modifies cancer risk in individuals carrying the inherited pathogenic gene variants in DNA mismatch repair genes (Lynch syndrome) remains understudied. We conducted a retrospective study with cancer register data to investigate associations between body weight, physical activity, and cancer risk among Finnish Lynch syndrome carriers (n = 465, 54% women). The results of our study indicated that longitudinal weight gain increases cancer risk, whereas being highly physically active during adulthood could decrease cancer risk in men. Further, women were observed to be less prone to lifestyle-related risk factors …

elintavatperinnölliset tauditMENOPAUSElifestyleMUTATIONS3122 Cancershereditary non-polyposis colorectal cancerylipainoEXERCISEsuolistosyövätriskitekijätlcsh:Neoplasms. Tumors. Oncology. Including cancer and carcinogenslcsh:RC254-282ArticleCOLORECTAL-CANCERESTROGENADIPOSE-TISSUEMASS INDEXAGEDEFINED FAMILIAL RISKepidemiologyepidemiologiaLynchin oireyhtymäfyysinen aktiivisuusASSOCIATIONSCancers
researchProduct

Perceived Burden among Spouse, Adult Child and Parent Caregivers

2018

adult child caregivernursingperceived caregiver burdenomaishoitajattyön kuormittavuuscaregivingparent caregiveromaishoitokoettu hyvinvointispouse caregivergeneral linear models
researchProduct

Effects of Physical and Cognitive Training on Gait Speed and Cognition in Older Adults : A Randomized Controlled Trial

2021

Gait speed is a measure of health and functioning. Physical and cognitive determinants of gait are amenable to interventions, but best practices remain unclear. We investigated the effects of a 12‐month physical and cognitive training (PTCT) on gait speed, dual‐task cost in gait speed, and executive functions (EFs) compared to physical training (PT) (ISRCTN52388040). Community‐dwelling older adults, who did not meet physical activity recommendations, were recruited (n=314). PT included supervised walking/balance (once weekly) and resistance/balance training (once weekly), home exercises (2‐3 times weekly) and moderate aerobic activity 150 minutes/week in bouts of >10 minutes. PTCT included …

walkingcommunity‐dwellingtoiminnanohjaus (psykologia)ikääntyminenexerciseagingfyysinen toimintakykyharjoitteluliikuntaexecutive functionshuman activitiesikääntyneetkävely
researchProduct

Normal-weight obesity and cardiometabolic risk : A 7-year longitudinal study in girls from prepuberty to early adulthood

2017

Objective: To study whether normal-weight obesity in childhood is associated with increased cardiometabolic risk in early adulthood. Methods: This study assessed data for 236 girls followed from prepuberty to early adulthood. Growth chart data were obtained from birth to 18 years. Body composition was assessed by dual-energy x-ray absorptiometry and cardiometabolic risk by calculating continuous clustered risk score (at ages 11, 14, and 18). The association of body weight status with cardiometabolic risk from childhood to early adulthood was examined. Results: Subjects with normal-weight obesity were virtually indistinguishable from their normal-weight lean peers in terms of relative body w…

childrencardiometabolic riskrasvaprosenttisydän- ja verisuonitauditlihavuuslapset (ikäryhmät)ylipainoadolescentsbody fat percentageriskitnormal-weight obesitypainonhallintakehonkoostumus
researchProduct

Additional file 1 of Retirement as a predictor of physical functioning trajectories among older businessmen

2022

Additional file 1: Supplementary Table 1. Model Fit Statistics, Group Sizes and Average Latent Class Probabilities for Most Likely Class Membership. Figures. Reproduced with permission from [15]. Supplementary Fig. 1. Individual observations belonging to each of the five identified physical functioning trajectories. Reproduced with permission from [15].

researchProduct

Accelerometer-measured and self-reported physical activity in relation to extraversion and neuroticism: a cross-sectional analysis of two studies

2020

Background Personality reflects relatively stable and pervasive tendencies in feeling, thinking and behaving. While previous studies have found higher extraversion and lower neuroticism to be linked to higher self-reported physical activity levels, larger studies using accelerometer-measured physical activity are lacking. This study investigated the cross-sectional associations of extraversion and neuroticism with both accelerometer-measured and self-reported physical activity and the role of these personality traits in possible discrepancies between these two measures of physical activity among Finnish adults. Methods Two community-dwelling samples were used in this study: a) 47–55-yr-old …

MalePersonality Inventorylcsh:GeriatricsExtraversion Psychologicaltraitsmental disordersAccelerometryHumansExerciseAgedNeuroticismitsearviointikiihtyvyysanturiexercisemittauspersoonallisuuden piirteetMiddle AgedTraitspersoonallisuusleisure timeAccelerometeraccelerometerlcsh:RC952-954.6Cross-Sectional Studiespersonalitymittarit (mittaus)FemaleSelf ReportLeisure timevapaa-aikafyysinen aktiivisuusResearch ArticlePersonalityBMC Geriatrics
researchProduct

supplement_material – Supplemental material for Effects of an individually targeted multicomponent counseling and home-based rehabilitation program o…

2020

Supplemental material, supplement_material for Effects of an individually targeted multicomponent counseling and home-based rehabilitation program on physical activity and mobility in community-dwelling older people after discharge from hospital: a randomized controlled trial by Katri M Turunen, Laura Aaltonen-Määttä, Timo Törmäkangas, Timo Rantalainen, Erja Portegijs, Sirkka Keikkala, Marja-Liisa Kinnunen, Taija Finni, Sarianna Sipilä and Riku Nikander in Clinical Rehabilitation

FOS: Clinical medicine110604 Sports MedicineFOS: Health sciences110904 Neurology and Neuromuscular Diseases110314 Orthopaedics
researchProduct

Associations of temperament and personality traits with frequency of physical activity in adulthood

2020

Temperament and physical activity (PA) have been examined in children and adolescents, but little is known about these associations in adulthood. Personality traits, however, are known to contribute to PA in adults. This study, which examined both temperament and personality characteristics at age 42 in relation to frequency of PA at age 50 (JYLS, n = 214-261), also found associations with temperament traits. Positive associations were found between Orienting sensitivity and overall PA and between Extraversion and vigorous PA among women and between low Negative affectivity and overall and vigorous PA among men. Furthermore, Orienting sensitivity and Agreeableness were associated with vigor…

temperamenttiadulthoodaikuisuusadult temperamentpersoonallisuuden piirteetpersonality traitphysical activityliikuntapersoonallisuusfyysinen aktiivisuus
researchProduct

Effect of physical activity councelling on disability in older people: A 2-year randomized controlled trial.

2008

OBJECTIVES: To study the effect of a physical activity counseling intervention on instrumental activity of daily living (IADL) disability. DESIGN: Primary care–based, single-blind, randomized controlled trial. SETTING: City of Jyväskylä, central Finland. PARTICIPANTS: Six hundred thirty-two people aged 75 to 81 who were able to walk 500 meters without assistance, were at most moderately physically active, had a Mini-Mental State Examination score greater than 21, had no medical contraindications for physical activity, and gave informed consent for participation. INTERVENTION: A single individualized physical activity counseling session with supportive phone calls from a physiotherapist ever…

ikääntyminenvammaisuustoimintakykyagingphysical activityliikuntaneuvontahuman activities
researchProduct

Effect of physical activity counseling on home care use in older people

2009

perusterveydenhuoltoagedprimary-carekotihoitoliikuntaneuvontaikääntyneetphysical activity counseling
researchProduct

Word and item features that affect measurement of vocabulary size in a multiple choice vocabulary task

1999

vocabulary sizetest theoryquantitative analysismulti-dimensional scalingmeasurementdiscriminant analysis
researchProduct

Physical function and lean body mass as predictors of bone loss after hip fracture: a prospective follow-up study

2020

Abstract Background: Predictors of bone deterioration after hip fracture have not been well characterized. The aim of this study was to examine the associations of physical function and lean body mass (LBM) with loss of bone density and strength in older people recovering from a hip fracture. Methods: A total of 81 over 60-year-old, community-dwelling men and women operated for a hip fracture participated in this 1-year prospective follow-up study. Distal tibia total volumetric bone mineral density (vBMDTOT, mg/cm³) and compressive strength index (BSI, g²/cm⁴) and mid-tibia cortical vBMD (vBMDCO, mg/cm³) and bending strength index (SSI, mm³) were assessed in both legs by peripheral quantita…

MaleAginglcsh:Diseases of the musculoskeletal systemfyysinen toimintakykyluuntiheysWalkingHip fracturemurtumatBone DensityBone mineral densityHumansProspective StudiespQCTAgedAged 80 and overTibiaHip FracturesMiddle AgedPhysical Functional PerformancelonkkaBone Diseases MetabolicikääntyminenlihasmassaLean body massMultivariate AnalysisBody CompositionLinear ModelsPhysical functionFemaleIndependent Livinglcsh:RC925-935human activitiesResearch ArticleFollow-Up StudiesBMC Musculoskeletal Disorders
researchProduct

Trait-specific tracking and determinants of body composition: a 7-year follow-up study of pubertal growth in girls

2009

BACKGROUND: Understanding how bone (BM), lean (LM) and fat mass (FM) develop through childhood, puberty and adolescence is vital since it holds key information regarding current and future health. Our study aimed to determine how BM, LM and FM track from prepuberty to early adulthood in girls and what factors are associated with intra- and inter-individual variation in these three tissues. METHODS: The study was a 7-year longitudinal cohort study. BM, LM and FM measured using dual-energy X-ray absorptiometry, self-reported dietary information, leisure time physical activity (LTPA) and other factors were assessed one to eight times in 396 girls aged 10 to 13 years (baseline), and in 255 moth…

ravintobody compositiongrowthkehon koostumusadolescencetrackingliikuntakasvu
researchProduct