Search results for "Effectiveness"

showing 10 items of 363 documents

Zgoda dłużnika na cesję wierzytelności, następnie potrąconej, a problem bezskuteczności czynności upadłego

2022

Celem badawczym pracy jest analiza relacji pomiędzy przepisami ustawy – Prawo upadłościowe, regulującymi bezskuteczność czynności prawnych, w tym tryb dochodzenia roszczeń pauliańskich, jeżeli przelew wierzytelności względem przyszłego upadłego, wymagający zgody dłużnika, następnie stanowi faktyczną podstawę do dokonania potrącenia przez cesjonariusza. Innymi słowy, jest to problem granic ochrony interesów masy upadłości w postępowaniu upadłościowym. Problem ten ma zarówno doniosłość teoretyczną, jak również znaczenie dla praktyki prawa o niewypłacalności. W pracy bronione jest zapatrywanie, że zgoda przyszłego upadłego na cesję wierzytelności nie jest bezskuteczną czynnością prawną. Funkcj…

judge-commissionerpotrąceniesędzia-komisarzzgoda na przelew wierzytelnościIneffectiveness of actionstransfer of receivablesconsent to transfer of receivablesset-offBezskuteczność czynnościprzelew wierzytelnościGdańskie Studia Prawnicze
researchProduct

Consumption behavior of eco-friendly products and applications of ICT innovation

2021

The purchase of eco-friendly products is encouraged by the governments due to its contributions to the sustainable development of the environment. It is therefore important to examine factors influencing the purchase of eco-friendly products. Based on the attitude-behavior-context (ABC) theory, this paper constructs a conceptual model, which explores how a consumer’s perceived effectiveness affects individuals’ purchase of eco-friendly products. In details, this paper attempts to examine the mediating role of consumption attitude of eco-friendly products, as well as the moderating effect of applications of information and communication technologies (ICT) innovation. Moreover, by building a …

kestävä kulutusperceived effectivenessconsumer attitudeICTkulutustottumuksettieto- ja viestintätekniikkaeco-friendly productkuluttajakäyttäytyminensustainabilityympäristöystävälliset tuotteetconsumption behavior
researchProduct

Paniikkihäiriön kognitiivis-konstruktiivinen ryhmämuotoinen terapia : behavioraalisesta näkökulmasta kohti konstruktiivista näkemystä

1997

kognitiivis-konstruktiivinen terapiafoobinen merkitysorganisaatioterapian tuloksellisuuscognitive-constructive therapypaniikkihäiriöryhmämuotoinen terapiapanic disordereffectiveness of therapykvalitatiivinen tutkimusgroup therapy
researchProduct

Investigating the success of ERP systems in Pakistan : end-users' perspective

2016

The global business environment is changing rapidly, and organisations from developing countries such as Pakistan have to re-engineer their business processes to meet the challenges of increased competition and rising customer expectations. Enterprise resource planning (ERP) systems intend to deliver many benefits, such as business automation, reduced operating costs, accurate demand forecasts, better decision-making and improved customer service. However, organisations adopting ERP systems encounter many types of problems that may lead to failures in processes, expectations and interactions. In order to address these failures, researchers have identified the critical success factors in the…

käytettävyysenterprise resource planning (ERP)multiple document interface (MDI)effectivenesscontext of usekäyttäjäkoulutuscritical success factorsusabilitylearnabilitykäyttöliittymätefficiencytoiminnanohjaus (organisaatiot)ERP application Helpend-user training materialoppaat (teokset)computer literacysingle document interface (SDI)toiminnanohjausjärjestelmätmenestystekijätkäyttöönotto
researchProduct

Interpersonal dynamics in 2-vs-1 contexts of football: the effects of field location and player roles

2019

This study analyzed the spatial-temporal interactions that sustained 2-vs-1 contexts in football at different field locations near the goal. Fifteen male players (under 15 years, age 13.2 ± 1.03 years, years of practice 4.2 ± 1.10 years), 5 defenders, 7 midfielders, and 3 attackers, participated in the study. Each participant performed a game to simulate a 2-vs-1 sub-phase as a ball carrier, second attacker, and defender at three different field locations, resulting in a total number of 142 trials. The movements of participants in each trial were recorded and digitized with TACTO software. Values of interpersonal distance between the ball carrier and defender and interpersonal angles betwee…

lcsh:BF1-990FootballEffectivenesspelianalyysiPlayers’ rolesPatterns of playlcsh:Psychologyjalkapalloplayers' rolesPsychologyAffordancesroolitGeneral PsychologyOriginal Research
researchProduct

Antecedents of daily team job crafting

2017

This study investigated potential antecedents of team job crafting defined as the extent to which team members engage together in increasing (social and structural) job resources and challenges, and decreasing hindering job demands. Mindful of the teamwork literature, we hypothesized that individual employee factors (self-efficacy for teamwork, daily affect), team features (team cohesion, climate) and the organizational context of teams (engaging leadership and organizational resources for teamwork) relate positively to daily team job crafting behaviour. Data were collected among 46 multi-professional rehabilitation teams whose members completed two daily surveys after their weekly meetings…

leadershipOrganizational Behavior and Human Resource Managementmedia_common.quotation_subjectApplied psychologyPsychological interventionTeam effectiveness050109 social psychologyPsychological safetyAffect (psychology)teamsJob craftingproactive behaviour0502 economics and businessTaverne0501 psychology and cognitive sciencesJob craftingta515Applied Psychologymedia_commonTeam compositionTeamworkComputingMilieux_THECOMPUTINGPROFESSION05 social sciencesCohesion (linguistics)antecedentsPsychologySocial psychology050203 business & management
researchProduct

Investigating the direct and indirect effects of a school-based leadership program for primary school students: Rationale and study protocol for the …

2023

Background Leadership is a valuable skill that can be taught in school, and which may have benefits within and beyond the classroom. Learning to Lead (L2L) is a student-led, primary school-based leadership program whereby older ‘peer leaders’ deliver a fundamental movement skills (FMS) program to younger ‘peers’ within their own school. Aim The aims of the study are to determine the efficacy of a peer-led FMS intervention on: (i) peer leaders’ (aged 10 to 12 years) leadership effectiveness (primary outcome), leadership self-efficacy, well-being, and time on-task in the classroom; (ii) peers’ (aged 8 to 10 years) physical activity levels, actual and perceived FMS competency, cardiorespirato…

leadershipvertaistukiMultidisciplinaryschool-based leadership programtuloksellisuusvertaisjohtamineneffectivenesskoululaisetlapset (ikäryhmät)peer leadersprimary school studentsfyysinen kuntofundamental movement skillsfyysinen aktiivisuusjohtajuusinterventiovertaissuhteetPLOS ONE
researchProduct

Spēlēs balstītas mācību platformas skolēnu angļu valodas vārdu krājuma bagātināšanai attālinātās mācībās 5. klasē

2020

Mūsdienās tehnoloģiju attīstības un distonciētās apmācības dēļ, strauji pieauga tiešsaišu komunikāciju un mācību platformu izmantošana cilvēku ikdienā. It īpaši, šī situācija skāra izglītības iestādes: skolas skolotājus, skolēnus un vecākus. Diplomdarba autors ir izpētījis vairākas spēļu balstītas mācību platformas, lai bagātinātu angļu valodas vārdu krājumu attālinātās mācībās 5. klasē. Autors ir analizējis literatūru par vārdu krājuma mācīšanos un platformu izmantošanu. Kā pētījuma metode tika izvēlēta gadījuma izpēte. Savukārt, kā datu iegūšanas metodes tika izmantotas angļu valodas skolotāju anketas, skolēnu (vecumā no 11 līdz 12 gadiem) pirms un pēc pētījuma anketas. Skolēniem bija ies…

learning platformsPedagoģijadistance learningteaching and learning vocabularyeffectiveness
researchProduct

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct

"Legislative Inflation" - An analysis of the Phenomenon in Contemporary Legal Discourse

2011

legal nihilismSociology and Political ScienceLegal pluralismeffectiveness of lawlegislative inflationKeuropean legal developmentLegal researchLegal realismLawPolitical scienceLegal opinionPhilosophy of lawEmpirical legal studiessymbolic lawsLegal nihilismLegal professionLawBaltic Journal of Law & Politics
researchProduct