Search results for "Enzyme Inhibitor"

showing 10 items of 627 documents

Inhibitory Action of Glufosinate on Photosynthesis

1993

Glufosinate (phosphinothricin) irreversibly blocks the glutamine synthetase which subsequently gives rise to an accumulation of ammonium and to a strong decrease in some amino acids, especially glutamine and glutamate. Under atmospheric conditions (400 ppm CO2, 21% O2) glufosinate causes a rapid inhibition of photosynthesis, too. H ow ever, under non-photo respiratory conditions (1000 ppm CO2, 2% O2) only a slight inhibition of photosynthesis occurs with glufosinate. Since under both conditions an accumulation of ammonium occurs, it is concluded that inhibition of photosynthesis is not induced by the higher concentrations of ammonium. The results rather suggest that the absence of amino don…

chemistry.chemical_classificationbiologyPhotosynthesisInhibitory postsynaptic potentialBiological effectGeneral Biochemistry Genetics and Molecular Biologychemistry.chemical_compoundEnzymeBiochemistryGlufosinatechemistryEnzyme inhibitorBotanybiology.proteinPhotorespirationZeitschrift für Naturforschung C
researchProduct

Non-steroidal Anti-inflammatory Agents, Part 24[1] Pyrrolidino Enaminones as Models to Mimic Arachidonic Acid

1997

The pyrrolidino enaminones, with the carboxylic acid chain fixed at the nitrogen, inhibit cyclooxygenase more potently or selectively than 5-lipoxygenase. According to the structure-activity relationships discussed the potency depends significantly on the chain length of the carboxylic acid, the substitution pattern of the heterocyclic moiety and of the phenyl group. Compound 4c is the most efficient inhibitor of cyclooxygenase. For the binding profile the unfolded conformation of arachidonic acid and the energy-minimized conformations of flurbiprofen, diclofenac, ML 3000, and lead compound 4a were compared. In addition to known structural features, similar distances of the carboxylic acid …

chemistry.chemical_classificationbiologyStereochemistryCarboxylic acidFlurbiprofenPharmaceutical Sciencechemistry.chemical_compoundchemistryEnzyme inhibitorDrug DiscoveryArachidonate 5-lipoxygenasemedicinebiology.proteinMoietyPhenyl groupArachidonic acidCyclooxygenasemedicine.drugArchiv der Pharmazie
researchProduct

Rollimembrin, a novel acetogenin inhibitor of mammalian mitochondrial complex I

1997

Abstract Rollimembrin (3), is a new adjacent bis-tetrahydrofuranic acetogenin with a scarce relative configuration, threo/cis/threo/cis/erythro, isolated from Rollinia membranacea seeds. The mechanism of cytotoxic activity, determined by NADH-oxidase experiments, establish that rollimembrin (3) is the most potent inhibitor of mammalian mitochondrial complex I.

chemistry.chemical_classificationbiologyStereochemistryOrganic ChemistryClinical BiochemistryAbsolute configurationPharmaceutical ScienceBiological activitybiology.organism_classificationBiochemistryIn vitrochemistry.chemical_compoundEnzymechemistryAnnonaceaeEnzyme inhibitorDrug DiscoveryAcetogeninbiology.proteinMolecular MedicineMolecular BiologyLactoneBioorganic & Medicinal Chemistry Letters
researchProduct

Intracerebral haemorrhage associated with sildenafil citrate

2001

chemistry.chemical_classificationmedicine.medical_specialtyNeurologybiologybusiness.industryVascular diseaseSildenafilPhosphoric Diester HydrolasesPharmacologymedicine.diseasechemistry.chemical_compoundEnzymeEndocrinologyNeurologychemistryEnzyme inhibitorInternal medicineToxicitybiology.proteinMedicineNeurology (clinical)businessNeuroradiologyJournal of Neurology
researchProduct

WRN protects against topo I but not topo II inhibitors by preventing DNA break formation

2008

The Werner syndrome helicase/3′-exonuclease (WRN) is a major component of the DNA repair and replication machinery. To analyze whether WRN is involved in the repair of topoisomerase-induced DNA damage we utilized U2-OS cells, in which WRN is stably down-regulated (wrn-kd), and the corresponding wild-type cells (wrn-wt). We show that cells not expressing WRN are hypersensitive to the toxic effect of the topoisomerase I inhibitor topotecan, but not to the topoisomerase II inhibitor etoposide. This was shown by mass survival assays, colony formation and induction of apoptosis. Upon topotecan treatment WRN deficient cells showed enhanced DNA replication inhibition and S-phase arrest, whereas af…

congenital hereditary and neonatal diseases and abnormalitiesWerner Syndrome HelicaseDNA RepairCell SurvivalDNA damageDNA repairBlotting WesternApoptosisBone NeoplasmsBiologyTopoisomerase-I InhibitorBiochemistryArticleWerner Syndrome HelicaseColony-Forming Units AssayHistonesTumor Cells CulturedmedicineHumansTopoisomerase II InhibitorsEnzyme InhibitorsRNA Small InterferingeducationMolecular BiologyEtoposideOsteosarcomaeducation.field_of_studyRecQ HelicasesTopoisomeraseCell CycleDNA Breaksnutritional and metabolic diseasesCell BiologyAntineoplastic Agents PhytogenicMolecular biologyDNA Topoisomerases Type IIExodeoxyribonucleasesBromodeoxyuridineDNA Topoisomerases Type IDNA Replication InhibitionCancer researchbiology.proteinTopoisomerase I InhibitorsTopoisomerase-II InhibitorTopotecanCamptothecinmedicine.drugDNA Repair
researchProduct

Retinoids as a Perspective in Treatment of Alzheimer’s Disease

2010

<i>Background:</i> In the past, we demonstrated that the disintegrin metalloproteinase ADAM10 has α-secretase activity in vitro and in cultured cells. We also found out that moderate overexpression of this proteinase inhibits Aβ peptide production and prevents the formation of amyloid plaques in an Alzheimer’s disease (AD) mouse model. Moreover, it corrects early hippocampal defects like LTP impairment and increases cortical synaptogenesis. <i>Objective:</i> Upregulation of ADAM10 might be an alternative approach concerning AD therapy. Our current research therefore focuses on substances and/or pathways which regulate ADAM10 gene expression. <i>Methods:</i&g…

endocrine systemMorpholinesADAM10DiseaseBiologyADAM10 ProteinMiceNeuroblastomaRetinoidsPromoter activityCell Line TumorDisintegrinAnimalsHumansEnzyme InhibitorsMetalloproteinaseDose-Response Relationship DrugTerpenesPerspective (graphical)Membrane ProteinsVitaminshumanitiesIn vitroUp-Regulationcarbohydrates (lipids)ADAM ProteinsNeurologyChromonesImmunologyCancer researchbiology.proteinNeurology (clinical)Amyloid Precursor Protein SecretasesSignal TransductionNeurodegenerative Diseases
researchProduct

Effect of cytochrome P450 inhibitors (diethyl dithiocarbamate, ketoconazole and grapefruit juice) on the pharmacokinetics of all-trans-retinoic acid.

2004

Diethyl dithiocarbamate (DEDTC) has been reported to be a more powerful inhibitor of all-trans-retinoic acid (ATRA) in vitro metabolism than the well-established cytochrome P450 (CYP) inhibitor ketoconazole (KC). In recent years grapefruit juice (GJ) has been shown to be able to increase the oral bioavailability of several drugs by inhibiting intestinal CYP. This study investigated the in vivo effect of these CYP inhibitors on the pharmacokinetics of ATRA. The latter was administered to rats as a constant-rate intravenous (i.v.) infusion (0.48 mg h(-1) kg(-1)) during 10 h and orally (1.6 mg kg(-1)). DEDTC (320 mg kg(-1) x 2 i.v., 6.4 and 32 mg kg(-1) per os (p.o.)) did not change the ATRA c…

food.ingredientRetinoic acidPharmaceutical ScienceTretinoinPharmacologyGrapefruit juiceBeverageschemistry.chemical_compoundfoodPharmacokineticsCytochrome P-450 Enzyme SystemIn vivoDrug DiscoverymedicineAnimalsCytochrome P-450 Enzyme InhibitorsEnzyme InhibitorsneoplasmsCytochrome P-450 Enzyme Inhibitorsbiologyorganic chemicalsCytochrome P450BioavailabilityRatsKetoconazolechemistrybiology.proteinKetoconazoleDitiocarbmedicine.drugCitrus paradisiFarmaco (Societa chimica italiana : 1989)
researchProduct

Ruta chalepensis L. (Rutaceae) leaf extract: chemical composition, antioxidant and hypoglicaemic activities.

2017

Ruta chalepensis L. (Rutaceae) leaf extract was investigated for its chemical profile and antioxidant and hypoglycaemic properties. The antioxidant effects were investigated by 2,2-diphenyl-1-picrylhydrazyl (DPPH), Chi-carotene bleaching, and metal chelating activity assays. The carbohydrate-hydrolysing enzymes inhibition assay was used to test the hypoglycaemic potential. R. chalepensis showed a high content of hesperidin and rutin with values of 591.9 and 266.7 mg/g dry extract, respectively. The extract exhibited a promising protection of lipid peroxidation (IC50 value of 16.9 mu g/mL) and inhibited both alpha-amylase and alpha-glucosidase enzymes in a concentration-dependent manner. The…

leaveMetal chelating activityAntioxidantDPPHmedicine.medical_treatmentRutinHPLC analysiantioxidant activityPlant Science01 natural sciencesBiochemistryAntioxidantsAnalytical ChemistryLipid peroxidationRutinchemistry.chemical_compoundHesperidinEnzyme InhibitorEnzyme InhibitorsTraditional medicinebiologyHydrolysisbeta CaroteneRuta chalepensisAntioxidantPlant Leavehypoglycaemic activityPlant Extractalpha-AmylaseInhibitory Concentration 50PicratesRuta chalepensiBotanymedicineGlycoside Hydrolase InhibitorsGlycoside Hydrolase InhibitorRutaDose-Response Relationship Drug010405 organic chemistryPlant ExtractsHesperidinOrganic ChemistryBiphenyl CompoundsSettore CHIM/06 - Chimica Organicabiology.organism_classificationHydrolysi0104 chemical sciencesPlant Leaves010404 medicinal & biomolecular chemistryRutaceaechemistryBiphenyl CompoundPicrateLipid Peroxidationalpha-AmylasesNatural product research
researchProduct

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct

Morelloflavone, a novel biflavonoid inhibitor of human secretory phospholipase A2 with anti-inflammatory activity

1997

Abstract The flavanonylflavone morelloflavone inhibited secretory phospholipase A 2 (PLA 2 ) in vitro , with a high potency on the human recombinant synovial and bee venom enzymes ( IC 50 = 0.9 and 0.6 μM, respectively). The inhibition was apparently irreversible. In contrast, the compound was inactive on cytosolic PLA 2 activity from human monocytes. Morelloflavone scavenged reactive oxygen species generated by human neutrophils ( IC 50 = 2.7 and 1.8 μM for luminol and lucigenin, respectively) but did not modify cellular responses such as degranulation or eicosanoid release. This biflavonoid exerted anti-inflammatory effects in animal models, with a potent inhibition of 12-O-tetradecanoylp…

medicine.drug_classAnti-Inflammatory AgentsPharmacologyBiochemistryPhospholipases AAnti-inflammatoryMicePhospholipase A2medicineAnimalsBiflavonoidsHumansEnzyme InhibitorsFlavonoidsPharmacologychemistry.chemical_classificationPhospholipase ADose-Response Relationship DrugbiologyChemistryDegranulationBiological activityBiflavonoidPhospholipases A2EicosanoidBiochemistryMyeloperoxidaseLuminescent Measurementsbiology.proteinFemaleBiochemical Pharmacology
researchProduct