Search results for "FINS"

showing 10 items of 70 documents

Photooxidations of Alkenes in Fluorinated Constrained Media:  Fluoro-organically Modified NaY as Improved Reactors for Singlet Oxygen “Ene” Reactions

2007

Creating a stationary fluorinated environment inside the zeolite cavity can increase the reactivity observed for intrazeolite photooxidation of alkenes. Exchanging the zeolite with fluorinated organic cations is a much more effective strategy than simply using a fluorinated solvent for slurry irradiations. Use of cations containing C-F bonds is also more efficient than use of deuterated cations for creation of a singlet oxygen friendly environment where the quenching processes are slowed down. Doping the zeolite with fluoro-organic cation 4 resulted in an increase in the singlet oxygen lifetime to 12 micros.

chemistry.chemical_classificationQuenching (fluorescence)ZEOLITESChemistryAlkeneSinglet oxygenOrganic ChemistryInorganic chemistryINTRAZEOLITE PHOTOOXIDATIONSLIFETIMEOXIDATIONPhotochemistrySolventchemistry.chemical_compoundCHEMISTRYReactivity (chemistry)Singlet stateDEACTIVATIONOLEFINSZeoliteEne reactionThe Journal of Organic Chemistry
researchProduct

Application of Silsesquioxanes in the Preparation of Polyolefin-Based Materials

2023

This paper is a review of studies on the use of the polyhedral oligomeric silsesquioxanes (POSS) of various structures in the synthesis of polyolefins and the modification of their properties, namely: (1) components of organometallic catalytic systems for the polymerization of olefins, (2) comonomers in the copolymerization with ethylene, and (3) fillers in composites based on polyolefins. In addition, studies on the use of new silicon compounds, i.e., siloxane–silsesquioxane resins, as fillers for composites based on polyolefins are presented. The authors dedicate this paper to Professor Bogdan Marciniec on the occasion of his jubilee.

copolymerizationPOSS-comonomersiloxane–silsesquioxane resinpolymerizationtransition metal–silsesquioxane complexcompositepolyolefinsolefinPOSScatalystMaterials
researchProduct

An easy access to fused chromanones via rhodium catalyzed oxidative coupling of salicylaldehydes with heterobicyclic olefins

2016

Abstract Herein we describe a detailed study on the rhodium catalyzed oxidative coupling of salicylaldehydes with heterobicyclic olefins such as diazabicyclic olefins and urea-derived bicyclic olefins. The developed method provides an ideal route to fused chromanone systems in a single synthetic step. Moreover, the scope of this methodology was extended to different oxa/aza-bridged bicyclic urea derivatives.

diazabicyclic olefinsBicyclic moleculechromanone010405 organic chemistryOrganic Chemistrychemistry.chemical_elementrhodium catalyzedsalicylaldehyde010402 general chemistry01 natural sciencesBiochemistry0104 chemical sciencesRhodiumCatalysischemistry.chemical_compoundchemistrySalicylaldehydeDrug DiscoveryOrganic chemistryOxidative coupling of methaneUrea derivativesta116urea derived bicyclic olefinsTetrahedron
researchProduct

An easy access to fused chromanones via rhodium catalyzed oxidative coupling of salicylaldehydes with heterobicyclic olefins

2016

Herein we describe a detailed study on the rhodium catalyzed oxidative coupling of salicylaldehydes with heterobicyclic olefins such as diazabicyclic olefins and urea-derived bicyclic olefins. The developed method provides an ideal route to fused chromanone systems in a single synthetic step. Moreover, the scope of this methodology was extended to different oxa/aza-bridged bicyclic urea derivatives. peerReviewed

diazabicyclic olefinschromanonerhodium catalyzedsalicylaldehydeurea derived bicyclic olefins
researchProduct

Lipschitz Carnot-Carathéodory Structures and their Limits

2022

AbstractIn this paper we discuss the convergence of distances associated to converging structures of Lipschitz vector fields and continuously varying norms on a smooth manifold. We prove that, under a mild controllability assumption on the limit vector-fields structure, the distances associated to equi-Lipschitz vector-fields structures that converge uniformly on compact subsets, and to norms that converge uniformly on compact subsets, converge locally uniformly to the limit Carnot-Carathéodory distance. In the case in which the limit distance is boundedly compact, we show that the convergence of the distances is uniform on compact sets. We show an example in which the limit distance is not…

differentiaaligeometriaNumerical AnalysissäätöteoriaControl and OptimizationAlgebra and Number Theorysub-Riemannian geometryMitchell’s theoremControl and Systems Engineeringsub-Finsler geometryLipschitz vector fieldsmittateoria
researchProduct

Attityder till finska språket och språklig identitet på Åland : en analys av åländska tidningar

2015

Tämän kvalitatiivisen tutkimuksen tarkoituksena on selvittää ahvenanmaalaisten kieliasenteita suomen kieltä kohtaan sekä millainen on yleinen käsitys ahvenmaalaisten kielellisestä identiteetistä kahdessa suurimmassa ahvenanmaalaisessa paikallislehdessä. Materiaali koostuu 64 erilaisesta mielipide- ja pääkirjoitusartikkelista, jotka on julkaistu 1.1.2007 – 31.12.2012 Nya Åland ja Ålandstidningen -lehdissä. Tutkimusmetodina käytettiin sisällönanalyysia ja diskurssianalyysiä. Kieliasenteita analysoitiin pääosin sisällönanalyysin avulla ja löydetyt argumentit luokiteltiin kommuni-katiivisiin, omakohtaisiin, kansallisiin ja oikeudellisiin argumentteihin. Tulosten mukaan asenteet ovat erilaisia e…

finska språketsuomen kielispråkdebattidentitetidentiteettiasenteetspråkattityderKvalitatiivinen tutkimusÅlandspråklig identitetkielellinen identiteettiAhvenanmaa
researchProduct

Mathematical Models and their Solutions for Domains of Compex Form

2014

Promocijas darbā tiek apskatīti dažādi oriģināli modeļi un to risinājumi sarežģītas formas apgabaliem. Intensīvās tērauda rūdīšanas procesi sistēmām ar ribām tiek aprakstīti ar 3D hiperbolisko, kā arī ar klasisko siltuma vadīšanas vienādojumu. Precīzā atrisinājuma iegūšanai izmantota Grīna funkciju metode un tās vispārinājums. Modernajos datoros sastopamajām sistēmām ar dubulsieniņu un dubultribu dota stacionārā un nestacionārā siltumvadīšanas problēma 2D gadījumā. Tās risinājums tiek iegūts ar konservatīvās viduvēšanas metodi, galīgo diferenču metodi un tās modifikāciju robežnosacījumiem. Piedāvāts jauns matemātiskais modelis vītola flautai, problēmas formulējumā izmantojot 1D lineāru viļņ…

galīgo diferenču metodeL-shape samplewillow fluteMathematical modellingMatemātiskā modelēšanakonservatīvā viduvēšanavītola flautaheat conduction equationssistēmas ar dubultsieniņu un dubultribuL-veida apgabalsGreen’s functionmethod of separation of variablesdouble wall with double finssiltuma vadīšanas vienādojumiGrīna funkcijamainīgo atdalīšanas metodeMatemātikawave equationviļņu vienādojumsconservative averagingMathematicsfinite difference method
researchProduct

Counterintuitive Mechanisms of the Addition of Hydrogen and Simple Olefins to Heavy Group 13 Alkene Analogues

2013

The mechanism of the reaction of olefins and hydrogen with dimetallenes ArMMAr (Ar = aromatic group; M = Al or Ga) was studied by density functional theory calculations and experimental methods. The digallenes, for which the most experimental data are available, are extensively dissociated to gallanediyl monomers, :GaAr, in hydrocarbon solution, but the calculations and experimental data showed also that they react with simple olefins, such as ethylene, as intact ArGaGaAr dimers via stepwise [2 + 2 + 2] cycloadditions due to their considerably lower activation barriers vis-à-vis the gallanediyl monomers, :GaAr. This pathway was preferred over the [2 + 2] cycloaddition of olefin to monomeric…

hydrogen additionvedyn additioolefinsalkeenianalogitolefiinitalkene analogues
researchProduct

Skriftliga och muntliga färdigheter i undervisning av svenska som modersmål vid gymnasiet i Finland : en fallstudie

2016

Tämän tutkielman tarkoitus oli tutkia ruotsi äidinkielenä opetusta lukion pakollisilla kursseilla Suomessa kirjallisten ja suullisten taitojen näkökulmista. Tarkoituksenani oli selvittää, mitä opettajat painottavat opetuksessa, millaisia tehtäviä, työskentelymenetelmiä ja työskentelytapoja he käyttävät. Tutkimusaineisto kerättiin kyselylomakkeella, joka lähetettiin kahdelle opettajalle ruotsinkieliseen lukioon Suomessa. Materiaali analysoitiin kvalitatiivisena tapaustutkimuksena. Kyselyyn vastanneet opettajat pitivät tärkeimpänä kielen mukauttamista tekstityyppiin. He painottivat taitoa osata kirjoittaa erilaisia tekstejä. Opettajat käyttävät kirjallisten taitojen opetuksessa referaatteja, …

modersmålsundervisningmodersmåldet finska gymnasietsvenska som modersmål
researchProduct

Affektiva faktorer i abiturienters finskinlärning i det finlandssvenska gymnasiet

2002

motivaatioinlärningmotivationsuomen kielioppiminenfinskafinlandssvenskarsuomenruotsalaisetasenteetattityder
researchProduct