Search results for "IU"

showing 10 items of 38021 documents

Long-term evolution of luminescent properties in CdI2 crystals

2016

Fresh and aged melt-grown or gas-phase grown CdI2 crystals are studied by means of low-temperature photoluminescence spectroscopy. Noticeable transformations of emission spectra are observed after long-term aging. The formation of nanostructures containing cadmium oxide and cadmium hydroxide as well as the changes in local surrounding of iodine atoms and the possible growth of polytypic modifications of CdI2 are taken into account when considering the diversity of optical spectra.

010302 applied physicsCadmium hydroxideZone meltingPhotoluminescenceMaterials sciencePhysics and Astronomy (miscellaneous)General Physics and Astronomy02 engineering and technology021001 nanoscience & nanotechnologyPhotochemistry01 natural sciencesSpectral linechemistry.chemical_compoundchemistry0103 physical sciencesCadmium oxideEmission spectrum0210 nano-technologySpectroscopyLuminescence
researchProduct

A half-metallic half-Heusler alloy having the largest atomic-like magnetic moment at optimized lattice constant

2016

For half-Heusler alloys, the general formula is XYZ, where X can be a transition or alkali metal element, Y is another transition metal element, typically Mn or Cr, and Z is a group IV element or a pnicitide. The atomic arrangements within a unit-cell show three configurations. Before this study, most of the predictions of half-metallic properties of half-Heusler alloys at the lattice constants differing from their optimized lattice constant. Based on the electropositivity of X and electronegativity of Z for half-Heusler alloys, we found that one of the configurations of LiCrS exhibits half-metallic properties at its optimized lattice constant of 5.803Å, and has the maximum atomic-like magn…

010302 applied physicsCondensed matter physicsMagnetic momentChemistryAlloyGeneral Physics and Astronomy02 engineering and technologyengineering.material021001 nanoscience & nanotechnologyAlkali metal01 natural scienceslcsh:QC1-999ElectronegativityMetalCondensed Matter::Materials ScienceLattice constantTransition metalGroup (periodic table)visual_art0103 physical sciencesengineeringvisual_art.visual_art_medium0210 nano-technologylcsh:PhysicsAIP Advances
researchProduct

A study of the optical effect of plasma sheath in a negative ion source using IBSIMU code

2020

A plasma sheath inside an ion source has a strong focusing effect on the formation of an ion beam from the plasma. Properties of the beam depend on the shape and location of the plasma sheath inside the source. The most accessible experimental data dependent on the plasma sheath are the beam phase space distribution. Variation of beam emittance is a reflection of the properties of the plasma sheath, with minimum emittance for the optimal shape of the plasma sheath. The location and shape of the plasma sheath are governed by complex physics and can be understood by simulations using plasma models in particle tracking codes like IBSimu. In the current study, a model of the D-Pace’s TRIUMF lic…

010302 applied physicsDebye sheathMaterials scienceIon beamPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesIon sourcenegative ion source010305 fluids & plasmassymbols.namesakeplasma sheathPhysics::Plasma Physics0103 physical sciencesPhysics::Space PhysicssymbolsPhysics::Accelerator PhysicsThermal emittanceStrong focusingBeam emittanceAtomic physicsInstrumentationBeam (structure)
researchProduct

Intrinsic nanostructures on the (001) surface of strontium titanate at low temperatures

2020

Atomically smooth (001) surfaces of SrTiO3 cut from the high-quality single crystals at two different miscut angles 0.9 and 7.0 deg between the real flat surfaces and crystallographic planes (001) were analyzed by means of the reflection high energy electron diffraction (RHEED) method from the room down to liquid helium temperatures. The diffraction patterns typical of the RHEED geometry close to ideal for a small miscut angle and those exhibiting distinct features of the specific periodicity associated with regular steps, which form due to the larger miscut angle, are presented. The surface symmetry and energetics were shown to impose differences in lattice parameters in parallel to a surf…

010302 applied physicsDiffractionMaterials scienceNanostructureReflection high-energy electron diffractionPhysics and Astronomy (miscellaneous)Condensed matter physicsGeneral Physics and Astronomy01 natural sciencesCondensed Matter::Materials Sciencesymbols.namesakechemistry.chemical_compoundchemistryElectron diffractionLattice (order)0103 physical sciencessymbolsStrontium titanate010306 general physicsRaman spectroscopySingle crystalLow Temperature Physics
researchProduct

Preparation, Characterisation and Dielectric Properties of YBa2Cu3O7-δ/ Insulator-Heterostructures

1996

YBa 2 Cu 3 O 7-δ /insulator/Au-heterostructures on SrTiO 3 or LaAlO 3 substrates were prepared to study the properties of the materials SrTiO 3 , BaTiO 3 and Ceo 2 . X-ray diffraction measurements in Bragg-Brentano geometry show c-axis-oriented growth for the superconductor and the insulators SrTiO 3 and CeO 2 . Typical values for the rocking curve width of the different insulating films are between 0.4° and 0.8°. The highest breakdown fields are measured for the insulator SrTiO 3 with +37.5 kV/mm and -8.8 kV/mm. The permittivity for CeO 2 is independent of applied field and only weakly temperature dependent. This is in contrast to the perovskite type insulators, where the permittivity depe…

010302 applied physicsDiffractionPermittivitySuperconductivityMaterials scienceCondensed matter physicsGeneral Physics and AstronomyMineralogyHeterojunctionInsulator (electricity)02 engineering and technologyDielectric021001 nanoscience & nanotechnology01 natural sciencesCapacitancechemistry.chemical_compoundchemistry[PHYS.HIST]Physics [physics]/Physics archives0103 physical sciencesStrontium titanate0210 nano-technology
researchProduct

Complex structural contribution of the morphotropic phase boundary in Na0.5Bi0.5TiO3 - CaTiO3 system

2019

Abstract The correlation between structure and dielectric properties of lead-free (1-x)Na0.5Bi0.5TiO3 - xCaTiO3 ((1-x)NBT - xCT) polycrystalline ceramics was investigated systematically by X-ray diffraction, combined with impedance spectroscopy for dielectric characterizations. The system shows high miscibility in the entire composition range. A morphotropic phase boundary (MPB), at 0.09 ≤ x

010302 applied physicsDiffractionPhase boundaryMaterials scienceProcess Chemistry and TechnologyThermodynamics02 engineering and technologyDielectric021001 nanoscience & nanotechnology01 natural sciencesMiscibilitySurfaces Coatings and FilmsElectronic Optical and Magnetic MaterialsDielectric spectroscopyvisual_art0103 physical sciencesMaterials ChemistryCeramics and Compositesvisual_art.visual_art_medium[CHIM]Chemical SciencesCrystalliteCeramic0210 nano-technology
researchProduct

Effect of Cu doping on Ba0.95Pb0.05TiO3 electrical properties studied by means of electrical impedance spectroscopy

2019

The ceramics of 0.95BaTiO3–0.05PbTiO3+Xwt.%CuO (X = 0.05, 0.1, 1, 3) were prepared by a solid phase reaction. The structural and morphology studies were carried out by means of X-ray diffraction te...

010302 applied physicsDiffractionPhase reactionMaterials scienceMorphology (linguistics)Analytical chemistry02 engineering and technology021001 nanoscience & nanotechnologyCondensed Matter Physics01 natural sciencesElectronic Optical and Magnetic MaterialsControl and Systems EngineeringCu dopingvisual_art0103 physical sciencesMaterials ChemistryCeramics and Compositesvisual_art.visual_art_mediumCeramicElectrical and Electronic Engineering0210 nano-technologyElectrical impedance spectroscopyIntegrated Ferroelectrics
researchProduct

Bandgap behavior and singularity of the domain-induced light scattering through the pressure-induced ferroelectric transition in relaxor ferroelectri…

2018

[EN] In this letter, we have investigated the electronic structure of A(x)Ba(1-x)Nb(2)O(6) relaxor ferroelectrics on the basis of optical absorption spectroscopy in unpoled single crystals with A = Sr and Ca under high pressure. The direct character of the fundamental transition could be established by fitting Urbach's rule to the photon energy dependence of the absorption edge yielding bandgaps of 3.44(1) eV and 3.57(1) eV for A = Sr and Ca, respectively. The light scattering by ferroelectric domains in the pre-edge spectral range has been studied as a function of composition and pressure. After confirming with x-ray diffraction the occurrence of the previously observed ferroelectric to pa…

010302 applied physicsDiffractionPhase transitionMaterials sciencePhysics and Astronomy (miscellaneous)Absorption spectroscopyCondensed matter physics02 engineering and technologyPhoton energy021001 nanoscience & nanotechnology01 natural sciencesFerroelectricityLight scatteringCRYSTALSTEMPERATURE-DEPENDENCEAbsorption edgeCALCIUM BARIUM NIOBATEFISICA APLICADA0103 physical sciencesDirect and indirect band gaps0210 nano-technologyCALCIUM BARIUM NIOBATE TEMPERATURE-DEPENDENCE CRYSTALS
researchProduct

RBS and ERD cross-sections and optical model parameters for the analysis of lithium, boron and nickel

2000

Abstract Elastic scattering cross-sections for RBS analysis of nickel by 7 Li and 11 B ion backscattering near the Coulomb barrier have been determined. The lithium ion measurements were performed in the energy range of 8–15 MeV at the laboratory angles of 115° and 135°. For boron ions the energies between 14 and 24 MeV and scattering angles of 89°, 110° and 130° were used. For the analysis of lithium and boron by ERD the scattering cross-sections have been calculated by kinematically reversing the backscattering process. The calculated 58 Ni ion energies thus varied between 65 and 125 MeV for lithium and between 75 and 130 MeV for boron recoils. For the Li + Ni and B + Ni systems the thres…

010302 applied physicsElastic scatteringNuclear and High Energy PhysicsScatteringchemistry.chemical_elementCoulomb barrier02 engineering and technology021001 nanoscience & nanotechnology7. Clean energy01 natural sciencesIonNickelsymbols.namesakechemistry0103 physical sciencessymbolsLithiumRutherford scatteringAtomic physics0210 nano-technologyBoronInstrumentationNuclear Instruments and Methods in Physics Research Section B: Beam Interactions with Materials and Atoms
researchProduct

Modeling self-sustaining waves of exothermic dissolution in nanometric Ni-Al multilayers

2016

Abstract The self-sustained propagating reaction occurring in nanometric metallic multilayers was studied by means of molecular dynamics (MD) and numerical modeling. We focused on the phenomenon of the exothermic dissolution of one metallic reactant into the less refractory one, such as Ni into liquid Al. The exothermic character is directly related to a negative enthalpy of mixing. An analytical model based on the diffusion-limited dissolution [1] coupled with heat transfer was derived to account for the main aspects of the process. Together, several microscopic simulations were carried out. The first series were set up to obtain all the parameters governing the process, including the heat…

010302 applied physicsExothermic reactionMaterials sciencePolymers and PlasticsMetals and AlloysThermodynamics02 engineering and technology021001 nanoscience & nanotechnologyEnthalpy of mixing01 natural sciencesElectronic Optical and Magnetic MaterialsMetalMolecular dynamicsCrystallographyScientific methodvisual_art0103 physical sciencesHeat transferCeramics and Compositesvisual_art.visual_art_mediumDiffusion (business)0210 nano-technologyDissolutionActa Materialia
researchProduct