Search results for "Syntax."

showing 8 items of 288 documents

25th Lexis and Grammar Conference

2008

multi-word expressions lexique-grammaire morpho-syntaxSettore L-LIN/01 - Glottologia E Linguistica
researchProduct

The submerged syntax between Late Antiquity and the Modern Age. Sources, models, and interpretative strategies

2021

The present volume contains selected papers from the international conference on “The submerged syntax between Late Antiquity and the Modern Age. Sources, models, and interpretative strategies”, that took place in Palermo, 28-29 November 2019, hosted by the Department of Humanities at the University of Palermo. The conference was organized under the umbrella of a project of national relevance funded by the Italian Ministry of Education, University and Research, named “Parts of speech meet rhetorics: searching for syntax in the continuity between the Middle Ages and the Modern Age” (PRIN 20172F2FEZ, March 2017).

Ancient and Medieval GrammariansWestern theory of SyntaxSettore L-LIN/01 - Glottologia E Linguistica
researchProduct

Perspectives on Language and Linguistics

2021

The scientific interests of Lucio Melazzo have been addressed to diverse research fields, from ancient to modern Indo-European languages, from etymology to formal syntax, from history of linguistics to studies on ancient Greek philosophers. On occasion of his retirement from his university activities, we have decided to offer him this volume, which gathers the contributions of many distinguished scholars who have accepted to participate in this project. We appreciate that the variety of the book contents reflects the variety of Lucio Melazzo’s own interests.

MorphologyAncient Indo-European LanguagesHistory of LinguisticEtymologySyntaxSettore L-LIN/01 - Glottologia E Linguistica
researchProduct

Kritische Anmerkungen zur H/B-Dreiteilung Vorgangspassiv - Zustandspassiv - allgemeine Zustandsform

2004

sein-reflexivetilarefleksiivipassivpassiivisyntaksisyntaxpassiivirestriktiotpassiv restrictions
researchProduct

La linguistica vista dalle Alpi. Teoria, lessicografia e multilinguismo

2019

Il volume raccoglie contributi che hanno come principale tema di ricerca la multiforme realtà linguistica dell’ambiente alpino. Essi indagano fenomeni linguistici di lingue standard e di minoranza appartenenti ai gruppi romanzo e germanico. Il libro si compone di quatto sezioni: modelli teorici, valenza e lessicografia, linguistica delle varietà e multilinguismo e le lingue nel Trentino-Alto Adige. The contributions of this book deal with the diverse linguistic situation of the Alps by focusing on phenomena of standard and minority languages which belong to the Romance and Germanic group. They address four main topics which correspond to the four sections of the book: linguistic theory, val…

cimbroLexicographytoponomasticaItalianToponomasticlinguistica delle varietàlingue di minoranzafriulanoVariety linguisticMultilingualismparticelle additiveMinority languageSettore L-LIN/01 - Glottologia E LinguisticaSouth TyrolItalian dialectFriulianlocativiAdditive particleLocative adverbpro-dropCliticmultilinguismoSyntaxlessicografiaCimbrianavverbi di luogosintagma nominaleLadinsintassidialetti italianiNull subject parameterValencyLanguage into Act Theoryparametro del soggetto nulloAlto AdigeGermantedescoladinoSettore L-LIN/02 - Didattica Delle Lingue ModerneNoun phraseitalianocliticivalenza verbaleTrentino
researchProduct

Grammar types in language explain tone sequence processing in music

2009

In this ERP study, linear and center-embedded musical sequences are built according to two artificial grammar types in language, named finite state grammar (FSG) and phrase structure grammar (PSG). The aim is to prove if neural sources and processing mechanisms for artificial grammar settings across domains are the same. Isochronous pitch sequences were constructed by two interval categories (3rd and 6th) in upward and downward direction. FSG sequences, which have the general form ABAB in artificial grammar, are translated into “small up/small down/large up/large down”. PSG sequences of form A[AB]B are transposed to “small up/large up/large down/small down”. In two ERP recordings testing FS…

grammar typesevent-related potentialsmusical syntaxhierarchical vs. linear structures
researchProduct

The Greek Verb. Morphology, Syntax, Semantics. Proceedings of the 8th International Meeting on Greek Linguistics. Agrigento, October 1-3, 2009

2014

Despite the difficulties of reconstructing the grammar of a dead language, studying Ancient Greek offers new insights for linguistic theory. The morphological complexity of the Greek verb with its highly intricate inflectional system provide a valuable basis for an in-depth-analysis of the mechanisms which regulate the functioning of a language. Studies on the Ancient Greek verb have also contributed significantly to the reconstruction of the Indo-European language since the early history of Linguistics in the nineteenth century. The conservative features preserved in the oldest stages of Greek allow us to rely on a solid basis to which every linguist must refer in investigating a model of …

etimologycognitive linguisticDistributed MorphologymorphologyAncient Greek verbal systemsemanticfunctional linguisticgrammatical categorietypological linguisticIndo-EuropeansyntaxpragmaticSettore L-LIN/01 - Glottologia E Linguistica
researchProduct

Syntax der lettischen Grammatik

1879

Manuskripts rokrakstā

Latvian language - syntaxLettische Sprache - SyntaxLettische Sprache - GrammatikLatviešu valoda - gramatikaLatvian language - grammar:HUMANITIES and RELIGION::Languages and linguistics::Other languages::Baltic languages [Research Subject Categories]Latviešu valoda - sintakseRokrakstu kolekcija
researchProduct