0000000000561713

AUTHOR

Risto Kronholm

showing 43 related works from this author

Plasma diagnostic tools for ECR ion sources : What can we learn from these experiments for the next generation sources

2019

International audience; The order-of-magnitude performance leaps of ECR ion sources over the past decades result from improvements to the magnetic plasma confinement, increases in the microwave heating frequency, and techniques to stabilize the plasma at high densities. Parallel to the technical development of the ion sources themselves, significant effort has been directed into the development of their plasma diagnostic tools. We review the recent results of Electron Cyclotron Resonance Ion Source (ECRIS) plasma diagnostics highlighting a number of selected examples of plasma density, electron energy distribution, and ion confinement time measurements, obtained mostly with the second-gener…

[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Solenoidmagnetic fieldshiukkaskiihdyttimetplasmafysiikka7. Clean energy01 natural sciencesbremsstrahlungElectron cyclotron resonance010305 fluids & plasmasIonoptical emission spectroscopySuperposition principleion sourcesPhysics::Plasma Physics0103 physical sciencesInstrumentation010302 applied physicsPhysics[PHYS]Physics [physics]plasma confinementplasma properties and parametersplasma diagnosticssyklotronitplasma heatingPlasmaIon sourceComputational physicsMagnetic fieldPlasma diagnostics
researchProduct

Inner shell ionization of argon in ECRIS plasma

2018

Abstract The volumetric K α emission rate of argon emitted from the electron cyclotron resonance (ECR) heated plasmas of the JYFL (University of Jyvaskyla, Department of Physics) 14 GHz ECR ion source (ECRIS) and the 14.5 GHz Grenoble Test Source (GTS) at iThemba Laboratory for Accelerator Based Sciences have been measured to gain an understanding of the influence of the ion source tune parameters on the absolute inner shell ionization rate. It was observed that the behaviour of the ionization rate and the extracted ion beam currents react differently, depending the parametric sweep performed. The neutral gas pressure and incident microwave power was found to have the strongest influence on…

Nuclear and High Energy PhysicsIon beamchemistry.chemical_elementplasmafysiikka01 natural sciencesinner shell ionization rateElectron cyclotron resonance010305 fluids & plasmasIonPhysics::Plasma PhysicsIonization0103 physical sciences010306 general physicsInstrumentationplasmaplasma (kaasut)PhysicsArgonta114volumetric emission ratePlasmaIon sourceECRISchemistryargonAtomic physicsMicrowaveNuclear Instruments and Methods in Physics Research Section A: Accelerators, Spectrometers, Detectors and Associated Equipment
researchProduct

Photoelectron Emission from Metal Surfaces Induced by Radiation Emitted by a 14 GHz Electron Cyclotron Resonance Ion Source

2015

Photoelectron emission measurements have been performed using a room-temperature 14 GHz ECR ion source. It is shown that the photoelectron emission from Al, Cu, and stainless steel (SAE 304) surfaces, which are common plasma chamber materials, is predominantly caused by radiation emitted from plasma with energies between 8 eV and 1 keV. Characteristic X-ray emission and bremsstrahlung from plasma have a negligible contribution to the photoelectron emission. It is estimated from the measured data that the maximum conceivable photoelectron flux from plasma chamber walls is on the order of 10% of the estimated total electron losses from the plasma. peerReviewed

010302 applied physicsMaterials scienceta114Physics::Instrumentation and DetectorsAstrophysics::High Energy Astrophysical PhenomenaCyclotron resonanceBremsstrahlungFOS: Physical sciencesPlasmaElectronphotoelectron emissionRadiation01 natural sciences7. Clean energyElectron cyclotron resonanceIon sourcePhysics - Plasma Physics010305 fluids & plasmasPlasma Physics (physics.plasm-ph)Physics::Plasma Physics0103 physical scienceselectron cyclotron resonance ion sourcesPlasma diagnosticsAtomic physicsInstrumentation
researchProduct

Limitations of electron cyclotron resonance ion source performances set by kinetic plasma instabilities.

2015

Electron cyclotron resonance ion source (ECRIS) plasmas are prone to kinetic instabilities due to anisotropy of the electron energy distribution function stemming from the resonant nature of the electron heating process. Electron cyclotron plasma instabilities are related to non-linear interaction between plasma waves and energetic electrons resulting to strong microwave emission and a burst of energetic electrons escaping the plasma, and explain the periodic oscillations of the extracted beam currents observed in several laboratories. It is demonstrated with a minimum-B 14 GHz ECRIS operating on helium, oxygen, and argon plasmas that kinetic instabilities restrict the parameter space avail…

Physicsta114Waves in plasmasCyclotronPlasmaElectronelectron cyclotron resonance ion sourceElectron cyclotron resonanceIon sourcelaw.inventionlawPhysics::Plasma PhysicsElectromagnetic electron waveAtomic physicsInstrumentationPlasma stabilitykinetic plasma instabilitiesThe Review of scientific instruments
researchProduct

Experimental evidence on microwave induced electron losses from ECRIS plasma

2018

The balance between warm and hot (>1 keV) electron density and their losses from the magnetic confinement system of an Electron Cyclotron Resonance Ion Source (ECRIS) plasma is considered to be one of the main factors determining the rate of the high charge state ion production. One of the key loss channels for heated electrons is thought to be induced by the injected microwaves. While this loss mechanism, referred to as rf-induced pitch angle scattering, has been studied theoretically and with computational tools, direct experimental evidence of its significance in minimum-B ECRIS plasmas remains limited. In this work, experimental evidence of microwave induced electron losses in the axial…

magnetic mirrorsElectron densityelectrorheological fluidsAtmospheric-pressure plasma7. Clean energy01 natural scienceselectromagnetic radiationElectron cyclotron resonance010305 fluids & plasmassähkömagneettinen säteilyMagnetic mirrormikroaallotion sources0103 physical sciencesplasma (kaasut)010302 applied physicsPhysicsplasma confinementta114Magnetic confinement fusionPlasmaCondensed Matter Physicselectronic structureIon sourcePlasma diagnosticsAtomic physicsPhysics of Plasmas
researchProduct

Experimental evidence on photo-assisted O− ion production from Al2O3 cathode in cesium sputter negative ion source

2020

The production of negative ions in cesium sputter ion sources is generally considered to be a pure surface process. It has been recently proposed that ion pair production could explain the higher-than-expected beam currents extracted from these ion sources, therefore opening the door for laser-assisted enhancement of the negative ion yield. We have tested this hypothesis by measuring the effect of various pulsed diode lasers on the O − beam current produced from Al 2O 3 cathode of a cesium sputter ion source. It is expected that the ion pair production of O − requires populating the 5d electronic states of neutral cesium, thus implying that the process should be provoked only with specific …

010302 applied physicsMaterials scienceGeneral Physics and Astronomy02 engineering and technologyPhoton energy021001 nanoscience & nanotechnologyLaser01 natural sciencesCathodeIon sourceIonlaw.inventionPhysics::Plasma PhysicslawSputtering0103 physical sciencesAtomic physics0210 nano-technologyBeam (structure)DiodeJournal of Applied Physics
researchProduct

Studying the double-frequency heating mode in ECRIS plasma using Kα diagnostics

2018

Despite the success of double-heating frequency in enhancing high charge state production, the underlying physics remains poorly understood. By combining three different diagnostic techniques i.e. Kα emission, optical emission and the extracted charge state distribution, it is now possible to assess the proposed explanations for the effectiveness of double-frequency heating against the experimental results. These results seem to indicate that the increase of plasma density accounts largely for the favorable behavior of this operation mode compared to single-frequency mode. peerReviewed

double-heating frequencyMaterials scienceta114syklotronitemissionMode (statistics)PlasmaAtomic physicsDouble frequencyplasmafysiikkaplasmaplasma (kaasut)emissio (fysiikka)
researchProduct

Estimating ion confinement times from beam current transients in conventional and charge breeder ECRIS

2019

International audience; Cumulative ion confinement times are probed by measuring decaying ion current transients in pulsed material injection mode. The method is applied in a charge breeder and conventional ECRIS yielding mutually corroborative results. The cumulative confinement time estimates vary from approximately 2 ms–60 ms with a clear dependence on the ion charge-to-mass ratio—higher charges having longer residence times. The long cumulative confinement times are proposed as a partial explanation to recently observed unexpectedly high ion temperatures. The results are relevant for rare ion beam (RIB) production as the confinement time and the lifetime of stable isotopes can be used f…

010302 applied physicsplasma sourcesMaterials scienceplasma diagnosticsIon beamStable isotope ratio[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Ion currentCharge (physics)plasmatekniikka7. Clean energy01 natural sciences010305 fluids & plasmasIonion sourcesplasma dischargesBreeder (animal)0103 physical sciencesAtomic physicsCurrent (fluid)InstrumentationBeam (structure)
researchProduct

The role of radio frequency scattering in high-energy electron losses from minimum-B ECR ion source

2021

Abstract The measurement of the axially lost electron energy distribution escaping from a minimum-B electron cyclotron resonance ion source in the range of 4–800 keV is reported. The experiments have revealed the existence of a hump at 150–300 keV energy, containing up to 15% of the lost electrons and carrying up to 30% of the measured energy losses. The mean energy of the hump is independent of the microwave power, frequency and neutral gas pressure but increases with the magnetic field strength, most importantly with the value of the minimum-B field. Experiments in pulsed operation mode have indicated the presence of the hump only when microwave power is applied, confirming that the origi…

010302 applied physics[PHYS]Physics [physics]High energyMaterials scienceScatteringAstrophysics::High Energy Astrophysical Phenomena[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]scatteringElectronhiukkaskiihdyttimetCondensed Matter Physicselektronit01 natural sciences7. Clean energyIon source010305 fluids & plasmasNuclear Energy and Engineering0103 physical sciencessirontaRadio frequencyAtomic physics
researchProduct

Measurements of the energy distribution of electrons lost from the minimum B-field -- the effect of instabilities and two-frequency heating

2020

Further progress in the development of ECR ion sources (ECRIS) requires deeper understanding of the underlying physics. One of the topics that remains obscure, though being crucial for the performance of the ECRIS, is the electron energy distribution (EED). A well-developed technique of measuring the EED of electrons escaping axially from the magnetically confined plasma of an ECRIS was used for the study of EED in unstable mode of plasma confinement, i.e. in the presence of kinetic instabilities. The experimental data were recorded for pulsed and CW discharges with a room-temperature 14 GHz ECRIS at the JYFL accelerator laboratory. The measurements were focused on observing differences bet…

010302 applied physicsPhysicsResonanceFOS: Physical sciencesPlasmaElectronhiukkaskiihdyttimetplasmafysiikka7. Clean energy01 natural sciencesPhysics - Plasma PhysicsElectron cyclotron resonanceIon source010305 fluids & plasmasMagnetic fieldIonPlasma Physics (physics.plasm-ph)Magnetic trap0103 physical sciencesAtomic physicsInstrumentation
researchProduct

Hydrogen plasma induced photoelectron emission from low work function cesium covered metal surfaces

2017

Experimental results of hydrogen plasma induced photoelectron emission from cesium covered metal surfaces under ion source relevant conditions are reported. The transient photoelectron current during the Cs deposition process is measured from Mo, Al, Cu, Ta, Y, Ni, and stainless steel (SAE 304) surfaces. The photoelectron emission is 2–3.5 times higher at optimal Cs layer thickness in comparison to the clean substrate material. Emission from the thick layer of Cs is found to be 60%–80% lower than the emission from clean substrates. peerReviewed

010302 applied physicsPhysicsta114HydrogenTantalumAnalytical chemistrytransitionchemistry.chemical_elementSubstrate (electronics)plasmasCondensed Matter Physics01 natural sciencesIon sourcework functions010305 fluids & plasmasion sourceschemistryAluminiumCaesium0103 physical sciencesWork functionLayer (electronics)photoemissionPhysics of Plasmas
researchProduct

The effect of microwave power on the Ar9+ and Ar13+ optical emission intensities and ion beam currents in ECRIS

2018

The production of Ar9+ and Ar13+ ions in an ECRIS plasma and the efficiency of the ion beam extraction and transport of the resulting Ar9+ and Ar13+ ion beams have been studied with the JYFL 14 GHz ECRIS by using optical emission spectroscopy and measurement of the m/q analyzed beam currents. The relative changes in both the optical emission and the ion beam current in CW mode as function of microwave power and in amplitude modulation (AM) operation mode are reported. The results indicate a discrepancy between the parametric dependence of high charge state ion densities in the core plasma and their extracted beam currents. The observation implies that in CW mode the ion currents could be li…

Materials scienceIon beamspektroskopiaplasmatekniikka7. Clean energy01 natural sciencesIonAmplitude modulationoptical emission spectroscopymikroaallotPhysics::Plasma Physics0103 physical sciences010306 general physicsplasma (kaasut)plasma010302 applied physicsta114ionitsyklotronitPlasmaCore (optical fiber)ionsPhysics::Accelerator PhysicsOptical emission spectroscopyAtomic physicsCurrent (fluid)Beam (structure)
researchProduct

Photoelectron emission induced by low temperature hydrogen plasmas

2018

Experimental results of low temperature hydrogen plasma induced photoelectron emission measurements comparing two different plasma heating methods are summarized. By exposing the samples to the vacuum ultraviolet radiation of a filament-driven multi-cusp arc discharge ion source and a 2.45 GHz microwave-driven ion source, it has been measured that the total photoelectron emission from various metal surfaces is on the order of 1 A per kW of plasma heating power, which can be increased by a factor of 2–3.5 with a thin layer of alkali metal. The possible effects of the photoelectrons on the plasma sheath structure are studied with a 1D collisionless model extended to include the contribution o…

Materials scienceHydrogenAnalytical chemistrychemistry.chemical_elementphotoelectron emissionplasmatekniikkaAstrophysics::Cosmology and Extragalactic AstrophysicsRadiationelektronit01 natural sciences010305 fluids & plasmasElectric arcsymbols.namesakePhysics::Plasma Physics0103 physical sciencesPhysics::Atomic and Molecular Clustersplasma010302 applied physicsDebye sheathta114ionittechnology industry and agriculturePlasmaPhotoelectric effectAlkali metalIon sourcechemistryPhysics::Space Physicsionssymbolsemissio (fysiikka)AIP Conference Proceedings
researchProduct

A novel approach to β-decay: PANDORA, a new experimental setup for future in-plasma measurements

2022

International audience; Theoretical predictions as well as experiments performed at storage rings have shown that the lifetimes of β-radionuclides can change significantly as a function of the ionization state. In this paper we describe an innovative approach, based on the use of a compact plasma trap to emulate selected stellar-like conditions. It has been proposed within the PANDORA project (Plasmas for Astrophysics, Nuclear Decay Observation and Radiation for Archaeometry) with the aim to measure, for the first time in plasma, nuclear β-decay rates of radionuclides involved in nuclear-astrophysics processes. To achieve this task, a compact magnetic plasma trap has been designed…

plasma diagnosticsastrofysiikkaPlasma trapGeneral Physics and AstronomynucleosynthesisBeta decayplasmatekniikkaplasmafysiikkaPlasma diagnosticsilmaisimetbeta decay; nucleosynthesis; plasma trap; plasma diagnosticsbeta decay[PHYS.ASTR]Physics [physics]/Astrophysics [astro-ph]ydinfysiikkaBeta decay; Nucleosynthesis; Plasma diagnostics; Plasma trapNucleosynthesisplasma trap
researchProduct

Ionization efficiency studies with charge breeder and conventional electron cyclotron resonance ion source

2013

Radioactive Ion Beams play an increasingly important role in several European research facility programs such as SPES, SPIRAL1 Upgrade, and SPIRAL2, but even more for those such as EURISOL. Although remarkable advances of ECRIS charge breeders (CBs) have been achieved, further studies are needed to gain insight on the physics of the charge breeding process. The fundamental plasma processes of charge breeders are studied in the frame of the European collaboration project, EMILIE, for optimizing the charge breeding. Important information on the charge breeding can be obtained by conducting similar experiments using the gas mixing and 2-frequency heating techniques with a conventional JYFL 14 …

010302 applied physicsIonizationMaterials scienceta114[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Particle acceleratorCharge (physics)Plasma7. Clean energy01 natural sciencesIon sourceElectron cyclotron resonanceIonlaw.inventionNuclear physicsBreeder (animal)lawIonization0103 physical sciences010306 general physicsInstrumentationComputingMilieux_MISCELLANEOUS
researchProduct

Cyclotron instability in the afterglow mode of minimum-B ECRIS.

2016

It was shown recently that cyclotron instability in non-equilibrium plasma of a minimum-B electron cyclotron resonance ion source (ECRIS) causes perturbation of the extracted ion current and generation of strong bursts of bremsstrahlung emission, which limit the performance of the ion source. The present work is devoted to the dynamic regimes of plasma instability in ECRIS operated in pulsed mode. Instability develops in decaying plasma shortly after heating microwaves are switched off and manifests itself in the form of powerful pulses of electromagnetic emission associated with precipitation of high energy electrons. Time-resolved measurements of microwave emission bursts are presented. I…

010302 applied physicsPhysicsta114ta213Astrophysics::High Energy Astrophysical Phenomenaplasma instabilityCyclotronBremsstrahlungPlasma01 natural sciencesInstabilityIon sourceElectron cyclotron resonance010305 fluids & plasmaslaw.inventionTwo-stream instabilityPhysics::Plasma Physicslaw0103 physical scienceselectron cyclotron resonance ion sourcesAtomic physicsInstrumentationIon cyclotron resonanceThe Review of scientific instruments
researchProduct

The effect of cavity tuning on oxygen beam currents of an A-ECR type 14 GHz electron cyclotron resonance ion source.

2016

The efficiency of the microwave-plasma coupling plays a significant role in the production of highly charged ion beams with electron cyclotron resonance ion sources (ECRISs). The coupling properties are affected by the mechanical design of the ion source plasma chamber and microwave launching system, as well as damping of the microwave electric field by the plasma. Several experiments attempting to optimize the microwave-plasma coupling characteristics by fine-tuning the frequency of the injected microwaves have been conducted with varying degrees of success. The inherent difficulty in interpretation of the frequency tuning results is that the effects of microwave coupling system and the ca…

010302 applied physicsMaterials scienceta114Highly charged ionPlasma01 natural sciencesElectron cyclotron resonanceIon sourcemicrowaves010305 fluids & plasmasIonmikroaallotPhysics::Plasma Physics0103 physical scienceselectron cyclotron resonance ion sourcesplasma chamberAtomic physicsInstrumentationBeam (structure)MicrowaveMicrowave cavityThe Review of scientific instruments
researchProduct

The biased disc of an electron cyclotron resonance ion source as a probe of instability-induced electron and ion losses

2019

International audience; Electron Cyclotron Resonance Ion Source (ECRIS) plasmas are prone to kinetic instabilities resulting in loss of electron and ion confinement. It is demonstrated that the biased disk of an ECRIS can be used as a probe to quantify such instability-induced electron and ion losses occurring in less than 10 µs. The qualitative interpretation of the data is supported by the measurement of the energy spread of the extracted ion beams implying a transient plasma potential >1.5 kV during the instability. A parametric study of the electron losses combined with electron tracking simulations allows for estimating the fraction of electrons expelled in each instability event to be…

010302 applied physics[PHYS]Physics [physics]Materials sciencesyklotronit[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]ElectronPlasmahiukkaskiihdyttimetKinetic energyplasmafysiikka01 natural sciencesInstabilityElectron cyclotron resonanceIon source010305 fluids & plasmasIonPhysics::Plasma Physics0103 physical sciencesTransient (oscillation)Atomic physicsInstrumentation
researchProduct

Microwave emission from ECR plasmas under conditions of two-frequency heating induced by kinetic instabilities

2018

Multiple frequency heating is one of the most effective techniques to improve the performances of ECR ion sources. It has been demonstrated that the appearance of the periodic ion beam current oscillations in ECRIS at high heating power and low magnetic field gradient is associated with kinetic plasma instabilities. Recently it was proven that one of the main features of multiple frequency heating is connected with stabilizing effect, namely the suppression of electron cyclotron instability in ECRIS plasmas. Due to this kind of stabilization it is possible to run the ion source in stable mode using higher total microwave power and thus to obtain better ion beam parameters. Unfortunately, ev…

Materials scienceta114ECR plasmasPlasmaplasmafysiikkamultiple frequency heatingKinetic energymikroaallotmicrowawesMicrowave emissionPhysics::Plasma Physicsplasma (kaasu)emissiontwo-frequency heatingAtomic physicsemissio (fysiikka)AIP Conference Proceedings
researchProduct

Beam current oscillations driven by cyclotron instabilities in a minimum-Belectron cyclotron resonance ion source plasma

2014

Experimental observation of cyclotron instabilities in a minimum-B confined electron cyclotron resonance ion source plasma is reported. The instabilities are associated with strong microwave emission and a burst of energetic electrons escaping the plasma, and explain the periodic ms-scale oscillation of the extracted beam currents. Such non-linear effects are detrimental for the confinement of highly charged ions due to plasma perturbations at shorter periodic intervals in comparison with their production time. It is shown that the repetition rate of the periodic instabilities in oxygen plasmas increases with increasing magnetic field strength and microwave power and decreases with increasi…

PhysicsCyclotronCyclotron resonancePlasmaequipment and suppliesCondensed Matter PhysicsLower hybrid oscillationElectron cyclotron resonanceFourier transform ion cyclotron resonanceIon sourcelaw.inventionPhysics::Plasma PhysicslawPhysics::Space PhysicsAtomic physicsIon cyclotron resonancePlasma Sources Science and Technology
researchProduct

Measurement of the energy distribution of electrons escaping minimum-B ECR plasmas

2017

The measurement of the electron energy distribution (EED) of electrons escaping axially from a minimum-B electron cyclotron resonance ion source (ECRIS) is reported. The experimental data were recorded with a room-temperature 14 GHz ECRIS at the JYFL accelerator laboratory. The electrons escaping through the extraction mirror of the ion source were detected with a secondary electron amplifier placed downstream from a dipole magnet serving as an electron spectrometer with 500 eV resolution. It was discovered that the EED in the range of 5–250 keV is strongly non-Maxwellian and exhibits several local maxima below 20 keV energy. It was observed that the most influential ion source operating pa…

electron energy distributionElectron spectrometerFOS: Physical sciencesElectronelektronitresonanssi01 natural sciences7. Clean energyElectron cyclotron resonanceSecondary electrons010305 fluids & plasmasmikroaallot0103 physical sciencesplasma010302 applied physicsPhysicsRange (particle radiation)energiaionitBremsstrahlungPlasmaCondensed Matter PhysicsIon sourcePhysics - Plasma PhysicsPlasma Physics (physics.plasm-ph)electrons escapingAtomic physics
researchProduct

Limitation of the ECRIS performance by kinetic plasma instabilities (invited).

2016

Electron cyclotron resonance ion source (ECRIS) plasmas are prone to kinetic instabilities due to anisotropic electron velocity distribution. The instabilities are associated with strong microwave emission and periodic bursts of energetic electrons escaping the magnetic confinement. The instabilities explain the periodic ms-scale oscillation of the extracted beam current observed with several high performance ECRISs and restrict the parameter space available for the optimization of extracted beam currents of highly charged ions. Experiments with the JYFL 14 GHz ECRIS have demonstrated that due to the instabilities the optimum Bmin-field is less than 0.8BECR, which is the value suggested by …

Physicsta114OscillationMagnetic confinement fusionPlasmaElectron01 natural sciencesplasma electronsElectron cyclotron resonanceIon source010305 fluids & plasmasIon0103 physical scienceselectron cyclotron resonance ion sourceskinetic instabilitiesAtomic physics010306 general physicsInstrumentationBeam (structure)The Review of scientific instruments
researchProduct

Spectroscopic study of ion temperature in minimum-B ECRIS plasma

2019

Experimentally determined ion temperatures of different charge states and elements in minimum-B confined electron cyclotron resonance ion source (ECRIS) plasma are reported. It is demonstrated with optical emission spectroscopy, complemented by the energy spread measurements of the extracted ion beams, that the ion temperature in the JYFL 14 GHz ECRIS is 5–28 eV depending on the plasma species and charge state. The reported ion temperatures are an order of magnitude higher than previously deduced from indirect diagnostics and used in simulations, but agree with those reported for a quadrupole mirror fusion experiment. The diagnostics setup and data interpretation are discussed in detail to …

010302 applied physicsMaterials scienceionitPlasma spectroscopyspektroskopiaAnalytical chemistryIon temperaturePlasmaCondensed Matter Physics7. Clean energy01 natural sciences010305 fluids & plasmasPhysics::Plasma Physicsion temperature0103 physical scienceslämpötilaspectroscopic studyOptical emission spectroscopyDoppler broadeningPlasma Sources Science and Technology
researchProduct

Microwave emission related to cyclotron instabilities in a minimum-Belectron cyclotron resonance ion source plasma

2015

Electron cyclotron resonance ion sources (ECRIS) have been essential in the research and applications of nuclear physics over the past 40 years. They are extensively used in a wide range of large-scale accelerator facilities for the production of highly charged heavy ion beams of stable and radioactive elements. ECRISs are susceptible to kinetic instabilities due to resonance heating mechanism leading to anisotropic electron velocity distribution function. Instabilities of cyclotron type are a proven cause of frequently observed periodic bursts of 'hot' electrons and bremsstrahlung, accompanied with emission of microwave radiation and followed by considerable drop of multiply charged ions c…

ChemistrylawWaves in plasmasCyclotronCyclotron resonanceBremsstrahlungAtomic physicsCondensed Matter PhysicsIon cyclotron resonanceIon sourceElectron cyclotron resonanceFourier transform ion cyclotron resonancelaw.inventionPlasma Sources Science and Technology
researchProduct

Kinetic instabilities in pulsed operation mode of a 14 GHz electron cyclotron resonance ion source

2016

The occurrence of kinetic plasma instabilities is studied in pulsed operation mode of a 14 GHz Aelectron cyclotron resonance type electron cyclotron resonance ion source. It is shown that the temporal delay between the plasma breakdown and the appearance of the instabilities is on the order of 10- 100 ms. The most important parameters affecting the delay are magnetic field strength and neutral gas pressure. It is demonstrated that kinetic instabilities limit the high charge state ion beam production in the unstable operating regime. peerReviewed

010302 applied physicsMaterials scienceta114Ion beamCyclotron resonancePlasma01 natural sciencesplasma electronsIon sourceElectron cyclotron resonanceFourier transform ion cyclotron resonance010305 fluids & plasmasMagnetic fieldpulsed operation modePhysics::Plasma Physics0103 physical scienceselectron cyclotron resonance ion sourceskinetic instabilitiesAtomic physicsInstrumentationIon cyclotron resonanceReview of Scientific Instruments
researchProduct

Ion source research and development at University of Jyväskylä: Studies of different plasma processes and towards the higher beam intensities

2015

MonPS16; International audience; The long-term operation of high charge state electron cyclotron resonance ion sources fed withhigh microwave power has caused damage to the plasma chamber wall in several laboratories.Porosity, or a small hole, can be progressively created in the wall on a year time scale, which cancause a water leak from the cooling system into the plasma chamber vacuum. A burnout of theVENUS chamber is investigated. Information on the hole formation and on the necessary localhot electron power density is presented. Next, the hot electron flux to the wall is studied bymeans of simulations. First, the results of a simple model assuming that electrons are fullymagnetized and …

010302 applied physicsbeam intensityMaterials scienceta114ta213plasma diagnostics[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Cyclotron resonanceElectronPlasma7. Clean energy01 natural sciencesElectron cyclotron resonanceIon source010305 fluids & plasmasIonBeamlinePhysics::Plasma Physics0103 physical scienceselectron cyclotron resonance ion sourcesPlasma diagnosticsAtomic physicsInstrumentation
researchProduct

Properties of Gd-Doped Sol-Gel Silica Glass Radioluminescence under Electron Beams

2022

International audience; The radiation-induced emission (RIE) of Gd3+-doped sol–gel silica glass has been shown to have suitable properties for use in the dosimetry of beams of ionizing radiation in applications such as radiotherapy. Linear electron accelerators are commonly used as clinical radiotherapy beams, and in this paper, the RIE properties were investigated under electron irradiation. A monochromator setup was used to investigate the light properties in selected narrow wavelength regions, and a spectrometer setup was used to measure the optical emission spectra in various test configurations. The RIE output as a function of depth in acrylic was measured and compared with a reference…

optiset kuidut[PHYS.PHYS.PHYS-OPTICS]Physics [physics]/Physics [physics]/Optics [physics.optics]optical fiberLuminescencedosimetryradiation-induced luminescencepulsed electron beamluminesenssiElectronsvaimennuselectron acceleratorBiochemistryAtomic and Molecular Physics and Opticspoint dosimeterAnalytical Chemistrydosimetry; electron accelerator; optical fiber; point dosimeter; pulsed electron beam; radiation-induced attenuation; radiation-induced luminescenceradiation-induced attenuationdosimetritGlassElectrical and Electronic EngineeringParticle AcceleratorsRadiometryInstrumentation
researchProduct

The effect of plasma instabilities on the background impurities in charge breeder ECRIS

2017

International audience; Experimental observations of plasma instabilities in the 14.5 GHz PHOENIX charge breeder ECRIS are summarized. It has been found that the injection of 133Cs+ or 85Rb+ into oxygen discharge of the CB-ECRIS can trigger electron cyclotron instabilities, which results to sputtering of the surfaces exposed to the plasma, followed by up to an order of magnitude increase of impurity currents in the extracted n+ charge state distribution. The transition from stable to unstable plasma regime is caused by gradual accumulation and ionization of Cs/Rb altering the discharge parameters in 10 - 100 ms time scale, not by a prompt interaction between the incident ion beam and the EC…

010302 applied physicsMaterials scienceIon beamta114syklotronit[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Buffer gasCyclotronPlasmaElectroncharge breederplasmafysiikka7. Clean energy01 natural sciences010305 fluids & plasmaslaw.inventionIonECRISSputteringlawIonization0103 physical sciencesAtomic physicsplasma (kaasut)plasma
researchProduct

Method for estimating charge breeder ECR ion source plasma parameters with short pulse 1+ injection of metal ions

2020

Abstract A new method for determining plasma parameters from beam current transients resulting from short pulse 1+ injection of metal ions into a charge breeder electron cyclotron resonance ion source has been developed. The proposed method relies on few assumptions, and yields local values for the ionisation times 1 / n e σ v q → q + 1 inz , charge exchange times 1 / n 0 σ v q → q − 1 cx , the ion confinement times τ q , as well as estimates for the minimum plasma energy contents n e E e and the plasma triple products n e E e τ q . The method is based on fitting the current balance equation on the extracted beam currents of high charge state ions, and using the fitting coefficients to dete…

PhysicsPlasma parameterssyklotronitCharge (physics)PlasmahiukkaskiihdyttimetplasmafysiikkaCondensed Matter Physics01 natural sciencesElectron cyclotron resonanceIon source010305 fluids & plasmasIonIonization0103 physical sciencesContent (measure theory)Atomic physics010306 general physicsPlasma Sources Science and Technology
researchProduct

Dynamic regimes of cyclotron instability in the afterglow mode of minimum-Belectron cyclotron resonance ion source plasma

2016

The paper is concerned with the dynamic regimes of cyclotron instabilities in non-equilibrium plasma of a minimum-B electron cyclotron resonance ion source operated in pulsed mode. The instability appears in decaying ion source plasma shortly (1–10 ms) after switching off the microwave radiation of the klystron, and manifests itself in the form of powerful pulses of electromagnetic emission associated with precipitation of high-energy electrons along the magnetic field lines. Recently it was shown that this plasma instability causes perturbations of the extracted ion current, which limits the performance of the ion source and generates strong bursts of bremsstrahlung emission. In this artic…

PhysicsAstrophysics::High Energy Astrophysical PhenomenaCyclotron resonanceCondensed Matter PhysicsLower hybrid oscillation01 natural sciencesElectron cyclotron resonanceFourier transform ion cyclotron resonance010305 fluids & plasmasTwo-stream instabilityNuclear Energy and EngineeringPhysics::Plasma Physics0103 physical sciencesElectromagnetic electron waveCyclotron radiationAtomic physics010306 general physicsIon cyclotron resonancePlasma Physics and Controlled Fusion
researchProduct

Broadband microwave emission spectrum associated with kinetic instabilities in minimum-B ECR plasmas

2017

Plasmas of electron cyclotron resonance ion sources (ECRISs) are prone to kinetic instabilities due to the resonant heating mechanism resulting in anisotropic electron velocity distribution. Frequently observed periodic oscillations of extracted ion beam current in the case of high plasma heating power and/or strong magnetic field have been proven to be caused by cyclotrontype instabilities leading to a notable reduction and temporal variation of highly charged ion production. Thus, investigations of such instabilities and techniques for their suppression have become important topics in ECRIS research. The microwave emission caused by the instabilities contains information on the electron e…

010302 applied physicsPhysicsRange (particle radiation)microwave sourcesIon sourcesIon beamta114Highly charged ionPlasmaAstrophysics::Cosmology and Extragalactic Astrophysicsplasma instabilitiesmagnetic fieldsCondensed Matter PhysicsPlasma oscillationmagneettikentät01 natural sciences7. Clean energyElectron cyclotron resonanceIonPhysics::Plasma Physicsmicrowave spectra0103 physical sciencesAtomic physics010306 general physicsMicrowave
researchProduct

A new 18 GHz room temperature electron cyclotron resonance ion source for highly charged ion beams

2020

An innovative 18 GHz HIISI (Heavy Ion Ion Source Injector) room temperature Electron Cyclotron Resonance (ECR) ion source (ECRIS) has been designed and constructed at the Department of Physics, University of Jyväskylä (JYFL), for the nuclear physics program of the JYFL Accelerator Laboratory. The primary objective of HIISI is to increase the intensities of medium charge states (M/Q ≅ 5) by a factor of 10 in comparison with the JYFL 14 GHz ECRIS and to increase the maximum usable xenon charge state from 35+ to 44+ to serve the space electronics irradiation testing program. HIISI is equipped with a refrigerated permanent magnet hexapole and a noncylindrical plasma chamber to achieve very stro…

010302 applied physicsMaterials scienceIon beamsyklotronittutkimuslaitteetHighly charged ionchemistry.chemical_elementhiukkaskiihdyttimet01 natural sciences7. Clean energyIon sourceElectron cyclotron resonance010305 fluids & plasmasIonXenonchemistry0103 physical sciencesIrradiationAtomic physicsInstrumentationBeam (structure)
researchProduct

VUV irradiance measurement of a 2.45 GHz microwave-driven hydrogen discharge

2015

Absolute values of VUV-emission of a 2.45 GHz microwave-driven hydrogen discharge are reported. The measurements were performed with a robust and straightforward method based on a photodiode and optical filters. It was found that the volumetric photon emission rate in the VUV-range (80-250 nm) is $10^{16}$-$10^{17}$ 1/cm$^3$s, which corresponds to approximately 8% dissipation of injected microwave power by VUV photon emission. The volumetric emission of characteristic emission bands was utilized to diagnostics of molecular plasma processes including volumetric rates of ionization, dissociation and excitation to high vibrational levels and metastable states. The estimated reaction rates impl…

Materials scienceAcoustics and UltrasonicsHydrogenchemistry.chemical_elementFOS: Physical sciencesPlasmaCondensed Matter Physics7. Clean energyPhysics - Plasma PhysicsSurfaces Coatings and FilmsElectronic Optical and Magnetic MaterialsPhotodiodelaw.inventionPlasma Physics (physics.plasm-ph)chemistrylawIonizationMetastabilityPhysics::Atomic and Molecular ClustersAtomic physicsMicrowaveElectron ionizationExcitation
researchProduct

Investigation into the gas mixing effect in ECRIS plasma using Kα and optical diagnostics

2018

Mixing a lighter gas species into the plasma of an ECRIS is known to enhance high charge state production of the heavier gas species. With this investigation, Kα diagnostics, optical emission spectroscopy and the measured charge state distribution of the extracted beam were combined to shed more light on the physics governing this phenomenon. Kα diagnostics data from two ion sources, the JYFL 14 GHz ECRIS and the GTS at iThemba LABS, are presented to gain confidence on the observed trends. The results seem to favor ion cooling as the most likely mechanism responsible for the favorable influence of the gas mixing.Mixing a lighter gas species into the plasma of an ECRIS is known to enhance hi…

Materials scienceta114ionitsyklotronitPlasmaplasmafysiikkaGas mixingIonNuclear physicsOptical diagnosticsIon coolingionsOptical emission spectroscopycyclotron resonanceState distributionplasmaplasma (kaasut)Beam (structure)AIP Conference Proceedings
researchProduct

Photoelectron emission experiments with ECR-driven multi-dipolar negative ion plasma source

2017

Photoelectron emission measurements have been performed using a 2.45 GHz ECR-driven multi-dipolar plasma source in a low pressure hydrogen discharge. Photoelectron currents induced by light emitted from ECR zone and H− production region are measured from Al, Cu, Mo, Ta, and stainless steel (SAE 304) surfaces as a function of microwave power and neutral hydrogen pressure. The total photoelectron current from the plasma chamber wall is estimated to reach values up to 1 A for 900 W of injected microwave power. It is concluded that the volumetric photon emission rate in wavelength range relevant for photoelectron emission is a few times higher in arc discharge. peerReviewed

plasma sourcesta114HydrogenWavelength rangeChemistryPhysics::Instrumentation and DetectorssyklotronitMicrowave powerAnalytical chemistrychemistry.chemical_elementPlasmaplasmatekniikkaelektronitIonElectric arcECR ion sourcesDipolePhysics::Plasma PhysicsPhysics::Atomic and Molecular ClustersphotoelectronsCurrent (fluid)Atomic physicsemissio (fysiikka)
researchProduct

Photo-assisted O− and Al− production with a cesium sputter ion source

2021

It has been recently proposed that the production of negative ions with cesium sputter ion sources could be enhanced by laser-assisted resonant ion pair production. We have tested this hypothesis by measuring the effect of pulsed diode lasers at various wavelengths on the O− and Al− beam current produced from Al2O3 cathode of a cesium sputter ion source. The experimental results provide evidence for the existence of a wavelength-dependent photo-assisted enhancement of negative ion currents but cast doubt on its alleged resonant nature as the effect is observed for both O− and Al− ions at laser energies above a certain threshold. The beam current transients observed during the laser pulses s…

Materials scienceionitchemistry.chemical_elementhiukkaskiihdyttimetLaserlasertekniikkaCathodeIon sourcelaw.inventionIonXenonchemistrylawSputteringPhysics::Plasma PhysicsCaesiumPhysics::Atomic PhysicsAtomic physicsBeam (structure)
researchProduct

Spectroscopic method to study low charge state ion and cold electron population in ECRIS plasma

2018

The results of optical emission spectroscopy experiments probing the cold electron population of a 14 GHz Electron Cyclotron Resonance Ion Source (ECRIS) are reported. The study has been conducted with a high resolution spectrometer and data acquisition setup developed specifically for the diagnostics of weak emission line characteristic to ECRIS plasmas. The optical emission lines of low charge state ions and neutral atoms of neon have been measured and analyzed with the line-ratio method. The aforementioned electron population temperature of the cold electron population (Te < 100 eV) is determined for Maxwell-Boltzmann and Druyvesteyn energy distributions to demonstrate the applicability …

Materials sciencespektroskopiachemistry.chemical_elementplasmafysiikka01 natural sciencesElectron cyclotron resonanceIonlow charge state ionNeonIonization0103 physical sciencesspectroscopic methodEmission spectrumcold electron populationInstrumentation010302 applied physicsta114010308 nuclear & particles physicssyklotronitPlasmaECRIS plasmaIon sourcechemistryPlasma diagnosticsAtomic physicsReview of Scientific Instruments
researchProduct

ECRIS plasma spectroscopy with a high resolution spectrometer

2020

Electron Cyclotron Resonance Ion Source (ECRIS) plasmas contain high-energy electrons and highly charged ions implying that only noninvasive methods such as optical emission spectroscopy are reliable in their characterization. A high-resolution spectrometer (10 pm FWHM at 632 nm) enabling the detection of weak emission lines has been developed at University of Jyväskylä, Department of Physics (JYFL) for this purpose. Diagnostics results probing the densities of ions, neutral atoms, and the temperature of the cold electron population in the JYFL 14 GHz ECRIS are described. For example, it has been observed that the cold electron temperature drops from 40 eV to 20 eV when the extraction volta…

Materials scienceIon beamspektroskopiaelectron impact ionizationphotomultipliers01 natural sciences7. Clean energyElectron cyclotron resonance010305 fluids & plasmasIonion sourcesPhysics::Plasma Physics0103 physical sciencesEmission spectrumInstrumentation010302 applied physicsplasma confinementamplitude modulationPlasmaIon sourceemission spectroscopymonochromatorsdoppler effectElectron temperatureAtomic physicsDoppler broadeningplasma spectroscopy
researchProduct

Periodic Beam Current Oscillations Driven by Electron Cyclotron Instabilities in ECRIS Plasmas

2014

Experimental observation of cyclotron instabilities in electron cyclotron resonance ion source plasma operated in cwmode is reported. The instabilities are associated with strong microwave emission and a burst of energetic electrons escaping the plasma, and explain the periodic oscillations of the extracted beam currents. The instabilities are shown to restrict the parameter space available for the optimization of high charge state ion currents. nonPeerReviewed

cyclotron instabilitiesPhysics::Plasma PhysicsAstrophysics::High Energy Astrophysical PhenomenaPhysics::Space PhysicsECRIS plasma
researchProduct

Photo-enhanced O−, H− and Br− ion production in caesium sputter negative ion source : no evidence for resonant ion pair production

2022

It has been proposed that the negative ion yield of a caesium sputter ion source could be enhanced by promoting neutral caesium atoms to electronically excited 7p states supporting resonant ion pair production. We have tested this hypothesis by illuminating the cathode of a caesium sputter ion source with an adjustable wavelength laser and measuring its effect on the extracted beam currents of O−, H− and Br− anions. The laser exposure causes the beam currents to increase but the effect is independent of the wavelength in the range of 440-460 nm, which leads us to conclude that there is no evidence for resonant ion pair production. The photon-induced beam current enhancement scales with the …

ionitcesiumionilähteethiukkaskiihdyttimetlasersäteily
researchProduct

Nopean kaasunsyöttölaitteiston, paineenmittauksen ja valodiagnostiikan kehittäminen ECR-ionilähteeseen

2014

Tämän tutkielman tarkoituksena oli kehittää laitteisto, jolla päästään tutkimaan neutraalien atomien vaikutusta ionisaation ja varauksenvaihdon kautta korkeasti varattujen ionien tuottoon ECR-ionilähteessä. Aluksi käsitellään ionilähteen plasmassa tapahtuvia ionisaatio- ja varauksenvaihtoreaktioita sekä näiden reaktioiden välisiä vapaita matkoja ja tapahtumistaajuuksia.Tämän jälkeen esitellään tasapainoyhtälö, jolla voidaan arvioidan eri varausasteisten ionien tiheyksien aikariippuvuutta. Tässä tutkielmassa kehitetyllä laitteistolla pyritään muodostamaan häiriö plasman tasapainotilaan ja näin päästä tutkimaan neutraalien vaikutusta korkeasti varattujen ionien tuottoon. Laitteisto, jolla häi…

ionitfysiikka
researchProduct

Plasma response to amplitude modulation of the microwave power on a 14 GHz electron cyclotron resonance ion source

2018

This paper reports the effects of sinusoidal microwave power Amplitude Modulation (AM) on the performance of Electron Cyclotron Resonance (ECR) ion sources. The study was conducted on the 14 GHz ECR ion source ECR2 at the University of Jyväskylä. The klystron output was intentionally altered by a variable frequency sinusoidal amplitude modulation. The average microwave power 350 W was modulated between 530 W and 180 W from 0.011-25 kHz. The integrated x-ray energy, the mass analyzed beam current and the forward and reflected microwave power were measured. The energy integrated x-ray signal responded strongly with low frequency modulation and was no longer observable at approximately 2.2 kHz…

mikroaallotsyklotronitplasmatekniikkacyclotron resonanceplasmaplasma (kaasut)
researchProduct

Dynamic regimes of cyclotron instability in the afterglow mode of minimum-B electron cyclotron resonance ion source plasma

2016

The paper is concerned with the dynamic regimes of cyclotron instabilities in non-equilibrium plasma of a minimum-B electron cyclotron resonance ion source operated in pulsed mode. The instability appears in decaying ion source plasma shortly (1–10 ms) after switching off the microwave radiation of the klystron, and manifests itself in the form of powerful pulses of electromagnetic emission associated with precipitation of high-energy electrons along the magnetic field lines. Recently it was shown that this plasma instability causes perturbations of the extracted ion current, which limits the performance of the ion source and generates strong bursts of bremsstrahlung emission. In this artic…

plasma diagnosticsPhysics::Plasma PhysicsAstrophysics::High Energy Astrophysical Phenomenacyclotron instabilityafterglow dischargemicrowave emissionZ-mode emissionelectron cyclotron resonance ion source
researchProduct