0000000000206982

AUTHOR

Dragos Vinereanu

showing 26 related works from this author

Early Treatment With Zofenopril and Ramipril in Combination With Acetyl Salicylic Acid in Patients With Left Ventricular Systolic Dysfunction After A…

2017

Abstract: The SMILE-4 study showed that in patients with left ventricular dysfunction (LVD) after acute myocardial infarction, early treatment with zofenopril plus acetyl salicylic acid is associated with an improved 1-year survival, free from death or hospitalization for cardiovascular (CV) causes, as compared to ramipril plus acetyl salicylic acid. We now report CV outcomes during a 5-year follow-up of the patients of the SMILE-4 study. Three hundred eighty-six of the 518 patients completing the study (51.2%) could be tracked after the study end and 265 could be included in the analysis. During the 5.5 (±2.1) years of follow-up, the primary endpoint occurred in 27.8% of patients originall…

MaleCaptoprilTime FactorsMyocardial InfarctionAngiotensin-Converting Enzyme InhibitorsKaplan-Meier Estimate030204 cardiovascular system & hematologyVentricular Function Leftchemistry.chemical_compoundVentricular Dysfunction Left0302 clinical medicineRetrospective StudieRisk FactorsClinical endpointOdds Ratiozofenopril030212 general & internal medicineMyocardial infarctionRandomized Controlled Trials as Topicleft ventricular dysfunctionMortality ratePharmacology; Cardiology and Cardiovascular MedicineMiddle AgedZofenoprilHospitalizationTreatment OutcomeCardiologyOriginal ArticleDrug Therapy CombinationFemaleCardiology and Cardiovascular MedicineHumanmedicine.drugRamiprilmedicine.medical_specialtyLogistic ModelTime FactorSystoleacute myocardial infarctionramiprilDisease-Free SurvivalDrug Administration ScheduleFollow-Up Studie03 medical and health sciencesStatistical significanceInternal medicineEarly Medical InterventionmedicineHumansIntensive care medicineAgedRetrospective StudiesPharmacologyChi-Square DistributionAspirinbusiness.industryRisk FactorAngiotensin-Converting Enzyme InhibitorOdds ratioRecovery of Functionmedicine.diseaseConfidence intervalLogistic ModelschemistryClinical Trials Phase III as Topicbusinessacetyl salicylic acidFollow-Up StudiesJournal of Cardiovascular Pharmacology
researchProduct

Echocardiographic reference ranges for normal left ventricular 2D strain: results from the EACVI NORRE study

2017

International audience; Aims - To obtain the normal ranges for 2D echocardiographic (2DE) measurements of left ventricular (LV) strain from a large group of healthy volunteers accounting for age and gender. Methods and results - A total of 549 (mean age: 45.6 ± 13.3 years) healthy subjects were enrolled at 22 collaborating institutions of the Normal Reference Ranges for Echocardiography (NORRE) study. 2DE data sets have been analysed with a vendor-independent software package allowing homogeneous measurements irrespective of the echocardiographic equipment used to acquire the data sets. The lowest expected values of LV strains and twist calculated as ± 1.96 standard deviations from the mean…

MaleLongitudinal straindeformation imaging[SDV]Life Sciences [q-bio]Sex Factor030204 cardiovascular system & hematologyStandard deviationVentricular Function LeftHeart Ventricle2D echocardiography0302 clinical medicineReference ValuesNuclear Medicine and ImagingImage Processing Computer-AssistedMedicineCircumferential strainAge FactorReference Value030212 general & internal medicineMultivariate Analysi2D echocardiography; Adult echocardiography; Deformation imaging; Reference values; Radiology Nuclear Medicine and Imaging; Cardiology and Cardiovascular MedicineObserver VariationStrain (chemistry)Age FactorsGeneral MedicineMiddle AgedHealthy VolunteerHealthy VolunteersEuropeHomogeneousEchocardiographyRadiology Nuclear Medicine and imagingCardiologyLinear ModelFemaleRadiologyCardiology and Cardiovascular MedicineRadial stressHumanAdultmedicine.medical_specialtyadult echocardiographyHeart Ventricles03 medical and health sciencesSex FactorsInternal medicineHumansRadiology Nuclear Medicine and imaging2d strainbusiness.industryMED/11 - MALATTIE DELL'APPARATO CARDIOVASCOLAREReference valuesMultivariate AnalysisLinear Modelsbusiness
researchProduct

Normal Reference Ranges for Echocardiography: Rationale, study design, and methodology (NORRE Study)

2013

International audience; BACKGROUND: Availability of normative reference values for cardiac chamber dimensions, volumes, mass, and function is a prerequisite for the accurate application of echocardiography for both clinical and research purposes. However, due to the lack of consistency in current echocardiographic 'reference values', their use for clinical decision-making remains questionable. AIMS: The aim of the 'Normal Reference Ranges for Echocardiography Study (NORRE Study)' is to obtain a set of 'normal values' for cardiac chamber geometry and function in a large cohort of healthy Caucasian individuals aged over a wide range of ages (25-75 years) using both conventional and advanced e…

MaleRadiology Nuclear Medicine and ImagingMESH: Echocardiography DopplerLeftSex Factor030204 cardiovascular system & hematologyDoppler echocardiographyDoppler imagingMESH: Stroke VolumeMESH: Ventricular Function LeftVentricular Function Left030218 nuclear medicine & medical imagingHeart VentricleCohort Studies0302 clinical medicine[INFO.INFO-TS]Computer Science [cs]/Signal and Image ProcessingNuclear Medicine and ImagingVentricular FunctionAge FactorProspective StudiesProspective cohort studyMESH: Cohort StudiesMESH: Aged2D and 3D echocardiographyMESH: Middle Agedmedicine.diagnostic_testAnthropometryAge FactorsDopplerGeneral MedicinePulsedReference Standardsreference valuesMiddle AgedCardiac mechanicEchocardiography Doppler3. Good healthEuropeMESH: Echocardiography Doppler PulsedCardiac mechanicsEchocardiographyMESH: Reference Standards[SDV.IB]Life Sciences [q-bio]/BioengineeringFemaleRadiologyCardiology and Cardiovascular Medicine[SPI.SIGNAL]Engineering Sciences [physics]/Signal and Image processingCohort study2D and 3D echocardiography; Cardiac mechanics; Chamber size and function; M-mode; reference values; Adult; Age Factors; Aged; Anthropometry; Cohort Studies; Echocardiography Doppler; Echocardiography Doppler Pulsed; Europe; Female; Heart Ventricles; Humans; Male; Middle Aged; Prospective Studies; Reference Standards; Sensitivity and Specificity; Sex Factors; Stroke Volume; Ventricular Function Left; Cardiology and Cardiovascular Medicine; Radiology Nuclear Medicine and ImagingHumanAdultmedicine.medical_specialtyHeart VentriclesM-modeChamber size and functionSensitivity and Specificity03 medical and health sciencesSex FactorsMESH: Sex FactorsMESH: Anthropometry[SDV.MHEP.CSC]Life Sciences [q-bio]/Human health and pathology/Cardiology and cardiovascular systemmedicineHumansMedical physicsAgedMESH: Age FactorsEchocardiography Doppler PulsedReproducibilityMESH: Humansbusiness.industryreference valueMESH: AdultStroke VolumeMESH: MaleMESH: Prospective StudiesMESH: Sensitivity and SpecificitySurgeryClinical trialProspective StudieSample size determinationReference StandardObservational studyMESH: EuropeMESH: Heart VentriclesCohort StudiebusinessMESH: Female
researchProduct

Echocardiographic reference ranges for normal cardiac Doppler data: results from the NORRE Study

2015

International audience; AIMS: Reference values for Doppler parameters according to age and gender are recommended for the assessment of heart physiology, specifically for left ventricular (LV) diastolic function. In this study, we report normal reference ranges for Doppler parameters obtained in a large group of healthy volunteers. Echocardiographic data were acquired using state-of-the-art cardiac ultrasound equipment following Doppler acquisition and measurement protocols approved by the European Association of Cardiovascular Imaging. METHODS AND RESULTS: A total of 449 (mean age: 45.8 ± 13.7 years) healthy volunteers (198 men and 251 women) were enrolled at the collaborating institutions…

MaleAgingLeft030204 cardiovascular system & hematologyDoppler echocardiographyVentricular Function LeftNORRE StudyCohort Studies0302 clinical medicineDiastoleReference ValuesNuclear Medicine and ImagingVentricular Function030212 general & internal medicineDoppler echocardiography; NORRE Study; reference values; systolic and diastolic function; Adult; Age Factors; Aged; Aging; Cohort Studies; Diastole; Echocardiography Doppler; Europe; Female; Healthy Volunteers; Heart Ventricles; Humans; Male; Middle Aged; Reference Values; Sex Factors; Systole; Ventricular Function Left; Young Adult; Radiology Nuclear Medicine and Imaging; Cardiology and Cardiovascular Medicinesystolic and diastolic functionmedicine.diagnostic_testDopplerAge FactorsGeneral MedicineMiddle AgedEchocardiography DopplerHealthy VolunteersCardiovascular physiologyEuropemedicine.anatomical_structureEchocardiographyCardiologysymbolsFemale[SDV.IB]Life Sciences [q-bio]/BioengineeringRadiologyCardiology and Cardiovascular MedicineDoppler effectCohort studyAdultmedicine.medical_specialtySystoleHeart VentriclesDiastole03 medical and health sciencessymbols.namesakeYoung AdultSex FactorsInternal medicinemedicineHumansRadiology Nuclear Medicine and imagingSystoleAgedbusiness.industryreference valueDoppler echocardiographyVentricleReference valuesbusiness
researchProduct

Impact of nutraceuticals on markers of systemic inflammation: Potential relevance to cardiovascular diseases - A position paper from the Internationa…

2021

Inflammation is a marker of arterial disease stemming from cholesterol-dependent to -independent molecular mechanisms. In recent years, the role of inflammation in atherogenesis has been underpinned by pharmacological approaches targeting systemic inflammation that have led to a significant reduction in cardiovascular disease (CVD) risk. Although the use of nutraceuticals to prevent CVD has largely focused on lipid-lowering (e.g, red-yeast rice and omega-3 fatty acids), there is growing interest and need, especially now in the time of coronavirus pandemic, in the use of nutraceuticals to reduce inflammatory markers, and potentially the inflammatory CVD burden, however, there is still not en…

RMArterial diseaseAnti-Inflammatory AgentsInflammationDiseaseC-reactive protein ; cardiovascular disease ; inflammation ; nutraceuticals ; omega-3 ; position paper ; red-yeast rice030204 cardiovascular system & hematologyBioinformaticsSystemic inflammationC-reactive protein03 medical and health sciences0302 clinical medicineNutraceuticalMedicineHumansPosition paper030212 general & internal medicineUncategorizedOmega-3InflammationbiologyC-reactive protein; Cardiovascular disease; Inflammation; Nutraceuticals; Omega-3; Position paper; Red-yeast rice; Anti-Inflammatory Agents; Biomarkers; Cardiovascular Diseases; Humans; Inflammation; Lipids; Dietary SupplementsVascular inflammationbusiness.industryC-reactive proteinC-reactive protein Cardiovascular disease Inflammation Nutraceuticals Omega-3 Position paper Red-yeast rice Anti-Inflammatory Agents Biomarkers Cardiovascular Diseases Humans Inflammation Lipids Dietary SupplementsCardiovascular diseaseRed-yeast riceLipidsCardiovascular DiseasesDietary Supplementsbiology.proteinPosition paperNutraceuticalsNutraceuticalmedicine.symptomCardiology and Cardiovascular MedicinebusinessBiomarkersProgress in cardiovascular diseases
researchProduct

Echocardiographic reference ranges for normal cardiac chamber size: Results from the NORRE study

2014

AimsAvailability of normative reference values for cardiac chamber quantitation is a prerequisite for accurate clinical application of echocardiography. In this study, we report normal reference ranges for cardiac chambers size obtained in a large group of healthy volunteers accounting for gender and age. Echocardiographic data were acquired using state-of-the-art cardiac ultrasound equipment following chamber quantitation protocols approved by the European Association of Cardiovascular Imaging.MethodsA total of 734 (mean age: 45.8 ± 13.3 years) healthy volunteers (320 men and 414 women) were enrolled at 22 collaborating institutions of the Normal Reference Ranges for Echocardiography (NORR…

MaleLower blood pressureSex FactorHeart VentricleCohort StudiesChamber size and function; Reference values; Two-dimensional echocardiography; Cardiology and Cardiovascular Medicine; Radiology Nuclear Medicine and Imaging; Medicine (all)Nuclear Medicine and ImagingAge FactorReference ValueYoung adultBody surface areaObserver VariationMedicine (all)Age FactorsGeneral MedicineStroke volumeMiddle AgedEchocardiographyCardiologyFemaleCardiology and Cardiovascular MedicineRadiologyHumanCohort studyAdultmedicine.medical_specialtyHeart VentriclesReproducibility of ResultChamber size and functionRisk AssessmentReference valuesYoung AdultSex FactorsTwo-dimensional echocardiographyInternal medicinemedicineHumansRadiology Nuclear Medicine and imagingHeart AtriaAgedbusiness.industryReproducibility of ResultsMean ageStroke VolumeMED/11 - MALATTIE DELL'APPARATO CARDIOVASCOLAREOriginal ArticlesCardiac chamberReference valuesCohort Studiebusiness
researchProduct

Zofenopril and ramipril in patients with left ventricular systolic dysfunction after acute myocardial infarction: A propensity analysis of the Surviv…

2016

Introduction: This was a propensity score analysis of the prospective, randomized, double-blind Survival of Myocardial Infarction Long-term Evaluation (SMILE) 4 study in which one-year treatment with zofenopril 60 mg plus acetylsalicylic acid (ASA) 100 mg gave superior results compared to ramipril 10 mg plus ASA in terms of death or hospitalization for cardiovascular causes in patients with acute myocardial infarction (AMI) complicated by left ventricular dysfunction (LVD). Materials and methods: A total of 716 patients of the intention-to-treat population were divided into homogeneous propensity quintiles (Q) using a logistic regression model (QI: best risk profile; QV: worst risk profile)…

MaleMedicine (General)Time FactorsCaptoprilIntention to Treat AnalysiLeftMyocardial Infarction030204 cardiovascular system & hematologychemistry.chemical_compoundVentricular Dysfunction Left0302 clinical medicineEndocrinologyRamiprilPropensity analysisAcetylsalicylic acid; Acute myocardial infarction; Angiotensin-converting enzyme inhibitors; Left ventricular dysfunction; Propensity analysis; Captopril; Demography; Drug Therapy Combination; Endpoint Determination; Female; Hospitalization; Humans; Intention to Treat Analysis; Male; Middle Aged; Myocardial Infarction; Ramipril; Survival Analysis; Time Factors; Ventricular Dysfunction Left; Propensity Score; Internal Medicine; EndocrinologyVentricular DysfunctionMedicine030212 general & internal medicineMyocardial infarctioneducation.field_of_studyLeft ventricular dysfunctionElectrocardiography in myocardial infarctionMiddle AgedZofenoprilIntention to Treat AnalysisHospitalizationCombinationCardiologyOriginal ArticleDrug Therapy CombinationFemaleSurvival AnalysiPropensity analysimedicine.drugHumanRamiprilmedicine.medical_specialtyTime FactorEndpoint DeterminationPopulationAcute myocardial infarction03 medical and health sciencesR5-920Drug TherapyInternal medicineAngiotensin-converting enzyme inhibitorsAcetylsalicylic acidInternal MedicineHumanseducationPropensity ScoreDemographybusiness.industryOdds ratiomedicine.diseaseSurvival AnalysisConfidence intervalchemistryAngiotensin-converting enzyme inhibitorPropensity score matchingbusiness
researchProduct

Cost-effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post hoc analysis of SMI…

2013

Claudio Borghi,1 Ettore Ambrosioni,1 Stefano Omboni,2 Arrigo FG Cicero,1 Stefano Bacchelli,1 Daniela Degli Esposti,1 Salvatore Novo,3 Dragos Vinereanu,4 Giuseppe Ambrosio,5 Giorgio Reggiardo,6 Dario Zava7 1Unit of Internal Medicine, Policlinico S Orsola, University of Bologna, Bologna, Italy; 2Italian Institute of Telemedicine, Varese, Italy; 3Division of Cardiology, University of Palermo, Palermo, Italy; 4University and Emergency Hospital, Bucharest, Romania; 5Division of Cardiology, University of Perugia, Perugia, Italy; 6Mediservice, Milano, Italy; 7Istituto Lusofarmaco d'Italia SpA, Peschiera Borromeo, Italy Background: In SMILE-4 (the Survival of Myocardial Infarction Long-term…

Ramiprilmedicine.medical_specialtyCost effectivenessEconomics Econometrics and Finance (miscellaneous)Populationacute myocardial infarctionramiprilchemistry.chemical_compoundInternal medicinePost-hoc analysismedicinezofenoprilMyocardial infarctioneducationcost-effectivenesshealth care economics and organizationsOriginal Researchleft ventricular dysfunctioneducation.field_of_studylcsh:R5-920business.industryHealth Policylcsh:RM1-950acetylsalicylic acidmedicine.diseaseSMILE studycost effectiveness analysis (CEA)Confidence intervalZofenoprilangiotensin-converting enzyme inhibitorsClinicoEconomics and Outcomes Researchlcsh:Therapeutics. PharmacologychemistryCardiologyNumber needed to treatMedical emergencybusinesslcsh:Medicine (General)medicine.drug
researchProduct

A putative placebo analysis of the effects of LCZ696 on clinical outcomes in heart failure

2015

Aims: Although active-controlled trials with renin–angiotensin inhibitors are ethically mandated in heart failure with reduced ejection fraction, clinicians and regulators often want to know how the experimental therapy would perform compared with placebo. The angiotensin receptor-neprilysin inhibitor LCZ696 was compared with enalapril in PARADIGM-HF. We made indirect comparisons of the effects of LCZ696 with putative placebos.\ud \ud Methods and results: We used the treatment-arm of the Studies Of Left Ventricular Dysfunction (SOLVD-T) as the reference trial for comparison of an ACE inhibitor to placebo and the Candesartan in Heart failure: Assessment of Reduction in Mortality and morbidit…

MaleTetrazolesAngiotensin-Converting Enzyme InhibitorsEnalaprilEnalapril/therapeutic useMedicineNatriuretic peptidesAngiotensin IIAminobutyratesHeart Failure/CardiomyopathyMiddle AgedAngiotensin Receptor Antagonists/therapeutic useHospitalizationAngiotensin-Converting Enzyme Inhibitors/therapeutic useDrug CombinationsTreatment OutcomeTetrazoles/therapeutic useCardiologyValsartanFemaleCardiology and Cardiovascular Medicinemedicine.drugBenzimidazoles/therapeutic usemedicine.medical_specialtyAngiotensin II Type 1 Receptor Blockers/therapeutic usemedicine.drug_classPlaceboAngiotensin Receptor AntagonistsInternal medicineHumansEnalaprilFASTTrack Clinical ResearchBeta blockerAgedHospitalization/statistics & numerical dataHeart Failurebusiness.industryBiphenyl Compoundsmedicine.diseaseHeart Failure/drug therapyPlacebo EffectAngiotensin IICandesartanEndocrinologyAminobutyrates/therapeutic useHeart failureACE inhibitorBenzimidazolesbusinessAngiotensin II Type 1 Receptor BlockersSacubitril ValsartanNatriuretic peptide
researchProduct

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct

Echocardiographic reference ranges for normal left ventricular layer-specific strain: results from the EACVI NORRE study

2020

Abstract Aims  To obtain the normal range for 2D echocardiographic (2DE) measurements of left ventricular (LV) layer-specific strain from a large group of healthy volunteers of both genders over a wide range of ages. Methods and results  A total of 287 (109 men, mean age: 46 ± 14 years) healthy subjects were enrolled at 22 collaborating institutions of the EACVI Normal Reference Ranges for Echocardiography (NORRE) study. Layer-specific strain was analysed from the apical two-, three-, and four-chamber views using 2DE software. The lowest values of layer-specific strain calculated as ±1.96 standard deviations from the mean were −15.0% in men and −15.6% in women for epicardial strain, −16.8% …

AdultMalemedicine.medical_specialtyadult echocardiographydeformation imagingHeart Ventricles030204 cardiovascular system & hematologyVentricular Function LeftReference values2D echocardiography03 medical and health sciences0302 clinical medicine[SDV.MHEP.CSC]Life Sciences [q-bio]/Human health and pathology/Cardiology and cardiovascular systemInternal medicinereference values.Healthy volunteersmedicineHumansRadiology Nuclear Medicine and imaging030212 general & internal medicineEndocardiumNormal rangeStrain (chemistry)business.industryMyocardiumHealthy subjectsreference valueMean ageGeneral MedicineMED/11 - MALATTIE DELL'APPARATO CARDIOVASCOLAREMiddle AgedApex (geometry)EchocardiographyCardiology[SDV.IB]Life Sciences [q-bio]/BioengineeringFemalebusinessLarge groupCardiology and Cardiovascular MedicineEndocardiumHuman
researchProduct

Randomised comparison of zofenopril and ramipril plus acetylsalicylic acid in postmyocardial infarction patients with left ventricular systolic dysfu…

2015

Objective Conflicting evidence exists on the benefits of treating patients with coronary artery disease and preserved left ventricular ejection fraction (LVEF) with an ACE inhibitor. This retrospective analysis of the SMILE-4 Study sought to compare the efficacy of zofenopril 60 mg plus acetylsalicylic acid (ASA) versus ramipril 10 mg plus ASA 100 mg in patients with acute myocardial infarction (AMI) and heart failure, according to an impaired or preserved LVEF. Methods The primary study end point was 1-year combined occurrence of death or hospitalisation for cardiovascular causes. A preserved LVEF was defined by a baseline LVEF >40% and an impaired one by an LVEF ≤40%. Results 448 patients…

Ramiprilmedicine.medical_specialtyacute myocardial infarctionInfarctionramiprilCoronary Artery DiseaseCoronary artery diseasechemistry.chemical_compoundInternal medicinemedicinezofenopril1506cardiovascular diseasesMyocardial infarctionleft ventricular dysfunctionEjection fractionbusiness.industryleft ventricular ejection fractionmedicine.diseaseZofenoprilangiotensin-converting enzyme inhibitorsangiotensin-converting enzyme inhibitorchemistryacute myocardial infarction; angiotensin-converting enzyme inhibitors; left ventricular dysfunction; left ventricular ejection fractionHeart failureACE inhibitorcardiovascular systemCardiologyCardiology and Cardiovascular Medicinebusinesscirculatory and respiratory physiologyBiomedical engineeringmedicine.drugOpen Heart
researchProduct

Lipid lowering nutraceuticals in clinical practice: position paper from an International Lipid Expert Panel.

2017

1.1. Cardiovascular disease and dyslipidemia: prevalence and global economic impact Cardiovascular diseases (CVDs) are the leading cause of mortality worldwide, reaching 31% of deaths in 2012 [1]. In particular, atherosclerosis and ischemic heart disease (IHD) are the main causes of premature death in Europe and are responsible for 42% of deaths in women and 38% in men under 75 years old [2]. The global economic impact of CVD is estimated to have been US $906 billion in 2015 and is expected to rise by 22% by 2030 [3]. Cardiovascular diseases also represent the major cause of disability in developed countries. It has been estimated that their growing burden could lead to a global increase in…

0301 basic medicineRED YEAST RICEDiseasePharmacologyPLACEBO-CONTROLLED TRIALchemistry.chemical_compound0302 clinical medicineCARDIOVASCULAR RISK-FACTORSFamily historyhealth care economics and organizationseducation.field_of_studyCONJUGATED LINOLEIC-ACIDOrvostudományokGeneral MedicinehumanitiesC-REACTIVE PROTEIN3. Good healthDENSITY-LIPOPROTEIN CHOLESTEROL030220 oncology & carcinogenesislipids (amino acids peptides and proteins)nutraceuticalLife Sciences & Biomedicineposition paperMODERATELY HYPERCHOLESTEROLEMIC SUBJECTSmedicine.medical_specialtyRANDOMIZED CONTROLLED-TRIALSeducationPopulationGuidelines/RecommendationsKlinikai orvostudományok03 medical and health sciencesMedicine General & InternallipidGeneral & Internal MedicineInternal medicineDiabetes mellitusmedicineCORONARY-HEART-DISEASERisk factoreducationFATTY LIVER-DISEASEScience & TechnologyCholesterolbusiness.industrydyslipidemia1103 Clinical Sciencesmedicine.disease030104 developmental biologychemistryrecommendationsEtiologybusinessDyslipidemiaArchives of medical science : AMS
researchProduct

3D echocardiographic reference ranges for normal left ventricular volumes and strain: results from the EACVI NORRE study

2017

International audience; Aim: To obtain the normal ranges for 3D echocardiography (3DE) measurement of left ventricular (LV) volumes, function, and strain from a large group of healthy volunteers. Methods and results: A total of 440 (mean age: 45 ± 13 years) out of the 734 healthy subjects enrolled at 22 collaborating institutions of the Normal Reference Ranges for Echocardiography (NORRE) study had good-quality 3DE data sets that have been analysed with a vendor-independent software package allowing homogeneous measurements regardless of the echocardiographic machine used to acquire the data sets. Upper limits of LV end-diastolic and end-systolic volumes were larger in men (97 and 42 mL/m2)…

AdultMalemedicine.medical_specialtyLongitudinal strainadult echocardiographydeformation imagingHeart VentriclesCardiac VolumeDiastoleEchocardiography Three-Dimensional030204 cardiovascular system & hematologyVentricular Function LeftHeart VentricleReference values03 medical and health sciencesYoung Adultleft ventricular function0302 clinical medicineInternal medicineHealthy volunteersthree-dimensional echocardiographyMedicineCircumferential strainHumansRadiology Nuclear Medicine and imagingReference Value030212 general & internal medicineSystoleAgedEjection fractionStrain (chemistry)business.industryGeneral MedicineMED/11 - MALATTIE DELL'APPARATO CARDIOVASCOLAREMiddle AgedHealthy VolunteerHealthy Volunteers3. Good healthRadiology Nuclear Medicine and imagingReference valuesCardiologyFemale[SDV.IB]Life Sciences [q-bio]/BioengineeringbusinessCardiology and Cardiovascular MedicineHuman
researchProduct

Two-dimensional transthoracic echocardiographic normal reference ranges for proximal aorta dimensions: Results from the EACVI NORRE study

2017

International audience; AIMS: To report normal reference ranges for echocardiographic dimensions of the proximal aorta obtained in a large group of healthy volunteers recruited using state-of-the-art cardiac ultrasound equipment, considering different measurement conventions, and taking into account gender, age, and body size of individuals. METHODS AND RESULTS: A total of 704 (mean age: 46.0 ± 13.5 years) healthy volunteers (310 men and 394 women) were prospectively recruited from the collaborating institutions of the Normal Reference Ranges for Echocardiography (NORRE) study. A comprehensive echocardiographic examination was obtained in all subjects following pre-defined protocols. Aortic…

MaleAorta ThoracicSex Factor030204 cardiovascular system & hematologyReproducibility of resultCohort Studies0302 clinical medicineDiastoleMedicineThoracic aortaAge FactorReference ValueProspective Studies030212 general & internal medicineMultivariate AnalysiBody surface areaCardiac cycleAge FactorsGeneral MedicineNORRE studyMiddle AgedHealthy VolunteerHealthy VolunteersEuropeEchocardiographyNORRE study; echocardiography; reference values; reproducibility of results; sinus of valsalva; thoracic aortaCardiologyLinear Model[SDV.IB]Life Sciences [q-bio]/BioengineeringFemaleCardiology and Cardiovascular MedicineHumanAdultmedicine.medical_specialtySystoleDiastoleNormal valuesThoracic aortaReference values03 medical and health sciencesYoung AdultSex FactorsInternal medicinemedicine.arteryAscending aortaHumansRadiology Nuclear Medicine and imagingMeasurement methodAortaAnalysis of Variancebusiness.industrySinus of valsalvaReproducibility of ResultsMED/11 - MALATTIE DELL'APPARATO CARDIOVASCOLAREProspective StudieMultivariate AnalysisLinear ModelsCohort Studiebusiness
researchProduct

Nutraceutical approaches to non-alcoholic fatty liver disease (NAFLD): A position paper from the International Lipid Expert Panel (ILEP)

2023

Non-Alcoholic Fatty Liver Disease (NAFLD) is a common condition affecting around 10–25% of the general adult population, 15% of children, and even > 50% of individuals who have type 2 diabetes mellitus. It is a major cause of liver-related morbidity, and cardiovascular (CV) mortality is a common cause of death. In addition to being the initial step of irreversible alterations of the liver parenchyma causing cirrhosis, about 1/6 of those who develop NASH are at risk also developing CV disease (CVD). More recently the acronym MAFLD (Metabolic Associated Fatty Liver Disease) has been preferred by many European and US specialists, providing a clearer message on the metabolic etiology of the dis…

PharmacologySettore MED/04 - Patologia GeneraleNAFLDLiver steatosisPosition paperDietary supplements; Liver steatosis; NAFLD; Nutraceuticals; Position paper;NutraceuticalsDietary supplements
researchProduct

Echocardiographic reference ranges for normal non-invasive myocardial work indices: results from the EACVI NORRE study

2019

International audience; Aims - To obtain the normal ranges for 2D echocardiographic (2DE) indices of myocardial work (MW) from a large group of healthy volunteers over a wide range of ages and gender. Methods and results - A total of 226 (85 men, mean age: 45 ± 13 years) healthy subjects were enrolled at 22 collaborating institutions of the Normal Reference Ranges for Echocardiography (NORRE) study. Global work index (GWI), global constructive work (GCW), global work waste (GWW), and global work efficiency (GWE) were estimated from left ventricle (LV) pressure-strain loops. Peak LV systolic pressure was non-invasively derived from brachial artery cuff pressure. The lowest values of MW indic…

Malemedicine.medical_specialtyadult echocardiographyWork efficiency030204 cardiovascular system & hematology2D echocardiography03 medical and health sciences0302 clinical medicineReference ValuesInternal medicinemedicine.arteryHealthy volunteersMedicineHumansRadiology Nuclear Medicine and imaging2D echocardiography; adult echocardiography; myocardial work; reference values.Prospective StudiesBrachial arteryadult echocardiography • 2D echocardiography • myocardial work • reference valuesbusiness.industryNon invasiveHealthy subjectsreference valueMean ageGeneral MedicineMED/11 - MALATTIE DELL'APPARATO CARDIOVASCOLAREMiddle Agedmyocardial workEuropeBlood pressureEchocardiographyHeart Function TestsCardiologyFemale[SDV.IB]Life Sciences [q-bio]/BioengineeringCardiology and Cardiovascular MedicinebusinessLarge group[SPI.SIGNAL]Engineering Sciences [physics]/Signal and Image processing
researchProduct

Statin therapy in athletes and patients performing regular intense exercise - Position paper from the International Lipid Expert Panel (ILEP)

2020

Abstract Acute and chronic physical exercises may enhance the development of statin-related myopathy. In this context, the recent (2019) guidelines of the European Society of Cardiology (ESC) and the European Atherosclerosis Society (EAS) for the management of dyslipidemias recommend that, although individuals with dyslipidemia should be advised to engage in regular moderate physical exercise (for at least 30 min daily), physicians should be alerted with regard to myopathy and creatine kinase (CK) elevation in statin-treated sport athletes. However it is worth emphasizing that abovementioned guidelines, previous and recent ESC/EAS consensus papers on adverse effects of statin therapy as wel…

0301 basic medicinemedicine.medical_specialtyConsensusSports medicineContext (language use)Physical exercise03 medical and health sciences0302 clinical medicineAthlethsMuscular DiseasesStatin intoleranceMedicineHumansAdverse effectAthlethExerciseMylagiaDyslipidemiasPharmacologybiologybusiness.industryAthletesExercisesAthleths Exercises Management Mylagia Statin intolerance.Athleths; Exercises; Management; Mylagia; Statin intolerancemedicine.diseasebiology.organism_classificationManagement030104 developmental biologyAthletes030220 oncology & carcinogenesisPhysical therapyPosition paperStatin therapyHydroxymethylglutaryl-CoA Reductase InhibitorsbusinessDyslipidemia
researchProduct

Efficacy and Safety of Zofenopril Versus Ramipril in the Treatment of Myocardial Infarction and Heart Failure: A Review of the Published and Unpublis…

2018

Zofenopril is a lipophilic, sulfhydryl group-containing angiotensin-converting enzyme (ACE)-inhibitor, characterized by wide tissue distribution, long duration of action, and pleiotropic effects on endothelial dysfunction. Its clinical efficacy and safety have been described in the four randomized controlled trials of the SMILE program, which globally enrolled more than 3600 patients in post-acute myocardial infarction (AMI) setting. The SMILE-4 study specifically selected patients with left ventricular dysfunction at admission, and compared the effects of zofenopril or ramipril in combination with acetylsalicylic acid (ASA). Zofenopril demonstrated its superiority over ramipril in reducing…

0301 basic medicineRamiprilmedicine.medical_specialtyCaptoprilPopulationMyocardial InfarctionCardiologyAngiotensin-Converting Enzyme InhibitorsHeart failureReviewAcute myocardial infarction030204 cardiovascular system & hematologylaw.inventionZofenopril03 medical and health scienceschemistry.chemical_compound0302 clinical medicineRandomized controlled trialDouble-Blind MethodRamiprillawInternal medicineAcute myocardial infarction; Angiotensin-converting enzyme inhibitors; Cardiology; Heart failure; Left ventricular dysfunction; Ramipril; Zofenopril; Pharmacology (medical)MedicineHumansPharmacology (medical)Myocardial infarctioneducationRandomized Controlled Trials as Topiceducation.field_of_studyLeft ventricular dysfunctionEjection fractionbusiness.industryGeneral Medicinemedicine.diseaseZofenopril030104 developmental biologyTreatment OutcomechemistryAngiotensin-converting enzyme inhibitorHeart failureCardiologyNumber needed to treatbusinessmedicine.drug
researchProduct

Correlation between non-invasive myocardial work indices and main parameters of systolic and diastolic function

2020

Abstract Aims The present study sought to evaluate the correlation between indices of non-invasive myocardial work (MW) and left ventricle (LV) size, traditional and advanced parameters of LV systolic and diastolic function by 2D echocardiography (2DE). Methods and results A total of 226 (85 men, mean age: 45 ± 13 years) healthy subjects were enrolled at 22 collaborating institutions of the Normal Reference Ranges for Echocardiography (NORRE) study. Global work index (GWI), global constructive work (GCW), global work waste (GWW), and global work efficiency (GWE) were estimated from LV pressure-strain loops using custom software. Peak LV pressure was estimated non-invasively from brachial ar…

AdultMalemedicine.medical_specialtySystoleadult echocardiographyDiastoleSpeckle tracking echocardiography030204 cardiovascular system & hematologyadult echocardiography; myocardial strain; myocardial work; speckle tracking echocardiographyVentricular Function LeftCorrelationVentricular Dysfunction Left03 medical and health sciences0302 clinical medicineDiastoleInternal medicinemedicineHumansRadiology Nuclear Medicine and imaging030212 general & internal medicineSystolespeckle tracking echocardiographyEjection fractionbusiness.industryWork (physics)Stroke VolumeMED/11 - MALATTIE DELL'APPARATO CARDIOVASCOLAREGeneral MedicineMiddle Agedmyocardial workmedicine.anatomical_structureBlood pressureEchocardiographyVentriclemyocardial strainCardiology[SDV.SPEE]Life Sciences [q-bio]/Santé publique et épidémiologieCardiology and Cardiovascular Medicinebusiness
researchProduct

Zofenopril is a cost-effective treatment for patients with left ventricular systolic dysfunction following acute myocardial infarction: a pharmacoeco…

2013

Objective: The Survival of Myocardial Infarction Long-term Evaluation 4 Study (SMILE-4) showed the superiority of Zofenopril (Z) associated with Acetylsalicylic Acid (ASA) as respect to Ramipril (R) plus ASA in reducing the occurrence of major cardiovascular events, in patients with left ventricular dysfunction (LVD) following Acute Myocardial Infarction (AMI). The objective of this retrospective analysis was the evaluation of cost-effectiveness of Z compared to R. Methods: 771 patients with LVD and AMI were randomized, double-blind to Z 60 mg/day (n=389) or R 10 mg/day (n=382) plus ASA 100 mg/day and followed-up for 1 year. The primary study end-point was 1-year combined occurrence of deat…

RamiprilPediatricsmedicine.medical_specialtyeducation.field_of_studybusiness.industryCost effectivenessSurrogate endpointPopulationmedicine.diseaseConfidence intervalZofenoprilchemistry.chemical_compoundchemistryInternal medicinemedicineCardiologyNumber needed to treatMyocardial infarctionCardiology and Cardiovascular Medicinebusinesseducationhealth care economics and organizationsmedicine.drugEuropean Heart Journal
researchProduct

Lipid-lowering nutraceuticals in clinical practice: position paper from an International Lipid Expert Panel

2017

In recent years, there has been growing interest in the possible use of nutraceuticals to improve and optimize dyslipidemia control and therapy. Based on the data from available studies, nutraceuticals might help patients obtain theraputic lipid goals and reduce cardiovascular residual risk. Some nutraceuticals have essential lipid-lowering properties confirmed in studies; some might also have possible positive effects on nonlipid cardiovascular risk factors and have been shown to improve early markers of vascular health such as endothelial function and pulse wave velocity. However, the clinical evidence supporting the use of a single lipid-lowering nutraceutical or a combination of them is…

PhytochemicalsMedicine (miscellaneous)030204 cardiovascular system & hematologyPharmacologyIntestinal absorption0302 clinical medicineRisk FactorsDrug Interactions030212 general & internal medicineRandomized Controlled Trials as TopicNutrition and DieteticsEvidence-Based MedicineOrvostudományok3. Good healthObservational Studies as TopicLiverCardiovascular DiseasesFatty Acids Unsaturatedlipids (amino acids peptides and proteins)nutraceuticalposition papermedicine.medical_specialtyStatinCombination therapymedicine.drug_classKlinikai orvostudományok03 medical and health sciencesMeta-Analysis as TopiclipidmedicineHumansIntensive care medicineLife StyleTriglyceridesDyslipidemiasbusiness.industryProbioticsdyslipidemiaCholesterol HDLEvidence-based medicineCholesterol LDLmedicine.diseaseResidual riskIntestinal AbsorptionrecommendationsDietary SupplementsPosition paperObservational Studies as TopicHydroxymethylglutaryl-CoA Reductase InhibitorsbusinessDyslipidemia
researchProduct

The Role of Nutraceuticals in Statin Intolerant Patients.

2018

Abstract Statins are the most common drugs administered for patients with cardiovascular disease. However, due to statin-associated muscle symptoms, adherence to statin therapy is challenging in clinical practice. Certain nutraceuticals, such as red yeast rice, bergamot, berberine, artichoke, soluble fiber, and plant sterols and stanols alone or in combination with each other, as well as with ezetimibe, might be considered as an alternative or add-on therapy to statins, although there is still insufficient evidence available with respect to long-term safety and effectiveness on cardiovascular disease prevention and treatment. These nutraceuticals could exert significant lipid-lowering activ…

Statinmedicine.drug_classDiseasecardiovascular risk ; dyslipidemia ; nutraceuticals ; position paper ; statin intolerance030204 cardiovascular system & hematologyBioinformaticsKlinikai orvostudományok03 medical and health sciences0302 clinical medicineNutraceuticalEzetimibeStatin intoleranceRed yeast riceMedicineHumansPosition paper030212 general & internal medicineEndothelial dysfunctionDyslipidemiasbusiness.industryClinical Studies as TopicOrvostudományokmedicine.diseaseCardiovascular risk3. Good healthDyslipidemiaDietary SupplementsArterial stiffnesslipids (amino acids peptides and proteins)nutraceuticalHydroxymethylglutaryl-CoA Reductase InhibitorNutraceuticalsHydroxymethylglutaryl-CoA Reductase InhibitorsCardiology and Cardiovascular MedicinebusinessDyslipidemiaposition papermedicine.drugstatin intoleranceHuman
researchProduct

Angiotensin Receptor Neprilysin Inhibition Compared With Enalapril on the Risk of Clinical Progression in Surviving Patients With Heart Failure

2015

Background— Clinical trials in heart failure have focused on the improvement in symptoms or decreases in the risk of death and other cardiovascular events. Little is known about the effect of drugs on the risk of clinical deterioration in surviving patients. Methods and Results— We compared the angiotensin-neprilysin inhibitor LCZ696 (400 mg daily) with the angiotensin-converting enzyme inhibitor enalapril (20 mg daily) in 8399 patients with heart failure and reduced ejection fraction in a double-blind trial. The analyses focused on prespecified measures of nonfatal clinical deterioration. In comparison with the enalapril group, fewer LCZ696-treated patients required intensification of med…

Angiotensin receptorVascular damage Radboud Institute for Health Sciences [Radboudumc 16]receptorsTetrazolesheart failureAngiotensin-Converting Enzyme InhibitorsKaplan-Meier EstimateSacubitrilAngiotensin; Heart failure; Neprilysin; Receptors; Aminobutyrates; Angiotensin Receptor Antagonists; Angiotensin-Converting Enzyme Inhibitors; Biomarkers; Double-Blind Method; Enalapril; Heart Failure; Humans; Kaplan-Meier Estimate; Natriuretic Peptide Brain; Neprilysin; Peptide Fragments; Risk Factors; Stroke Volume; Survivors; Tetrazoles; Treatment Outcome; Troponin; Disease Progression; Medicine (all); Cardiology and Cardiovascular Medicine; Physiology (medical)AngiotensinEnalaprilRisk FactorsEnalapril/therapeutic useNatriuretic Peptide BrainHeart Failure/bloodSurvivorsReceptorNeprilysinAminobutyrates: Systèmes cardiovasculaire & respiratoire [D03] [Sciences de la santé humaine]Troponin/bloodTroponinAngiotensin Receptor Antagonists/therapeutic useDrug CombinationsAngiotensin-Converting Enzyme Inhibitors/therapeutic useTreatment OutcomeTetrazoles/therapeutic useCardiologyDisease ProgressionValsartanNeprilysinHeart Failure/blood/drug therapy/physiopathologyCardiology and Cardiovascular Medicinemedicine.drugReceptormedicine.medical_specialtyHeart failureneprilysinAngiotensin Receptor Antagonistsreceptors angiotensinDouble-Blind MethodPhysiology (medical)Internal medicineRenin–angiotensin systemmedicineHumansheart failure neprilysin receptors angiotensinEnalaprilbusiness.industryBiphenyl CompoundsStroke Volumemedicine.diseasePeptide FragmentsEndocrinologyAminobutyrates/therapeutic useStroke Volume/physiologyHeart failureNatriuretic Peptide Brain/blood: Cardiovascular & respiratory systems [D03] [Human health sciences]businessNeprilysin/antagonists & inhibitorsPeptide Fragments/bloodSacubitril ValsartanBiomarkersBiomarkers/blood
researchProduct

Zofenopril and Ramipril in Combination with Acetyl Salicylic Acid in Postmyocardial Infarction Patients with Left Ventricular Systolic Dysfunction: A…

2016

Summary Objective In the SMILE-4 study, zofenopril + acetyl salicylic acid (ASA) was more effective than ramipril + ASA on 1-year prevention of major cardiovascular events (MACE) in patients with acute myocardial infarction complicated by left ventricular dysfunction. In this retrospective analysis, we evaluated drug efficacy in subgroups of patients, according to a history of diabetes mellitus. Methods The primary study endpoint was 1-year combined occurrence of death or hospitalization for cardiovascular causes. Diabetes was defined according to medical history (previous known diagnosis). Results A total of 562 of 693 (81.0%) patients were classified as nondiabetics and 131 (18.9%) as dia…

MaleCaptoprilDiabetic CardiomyopathiesMyocardial InfarctionInfarctionAngiotensin-Converting Enzyme Inhibitors030204 cardiovascular system & hematologychemistry.chemical_compoundVentricular Dysfunction Left0302 clinical medicineDiabetes mellitusRamiprilRetrospective StudieCardiovascular DiseaseMedicinePharmacology (medical)030212 general & internal medicineMyocardial infarctionDiabetic CardiomyopathieRandomized Controlled Trials as TopicAspirinLeft ventricular dysfunctionGeneral MedicineAcetyl salicylic acid; Acute myocardial infarction; Angiotensin-converting enzyme inhibitors; Diabetes mellitus; Left ventricular dysfunction; Ramipril; Zofenopril; Cardiology and Cardiovascular Medicine; Pharmacology (medical); PharmacologyMiddle AgedZofenoprilAcetyl salicylic acidCardiovascular DiseasesCardiologyPlatelet aggregation inhibitorDrug Therapy CombinationFemaleCardiology and Cardiovascular Medicinemedicine.drugHumanRamiprilmedicine.medical_specialtyDiabetes mellituSystoleAcute myocardial infarctionZofenopril03 medical and health sciencesDiabetes mellitusInternal medicineHumansAgedRetrospective StudiesPharmacologyAspirinbusiness.industryPlatelet Aggregation InhibitorAngiotensin-Converting Enzyme Inhibitormedicine.diseasechemistryAngiotensin-converting enzyme inhibitorbusinessMacePlatelet Aggregation Inhibitors
researchProduct

Rationale, design, and baseline characteristics in Evaluation of LIXisenatide in Acute Coronary Syndrome, a long-term cardiovascular end point trial …

2015

BACKGROUND: Cardiovascular (CV) disease is the leading cause of morbidity and mortality in patients with type 2 diabetes mellitus (T2DM). Furthermore, patients with T2DM and acute coronary syndrome (ACS) have a particularly high risk of CV events. The glucagon-like peptide 1 receptor agonist, lixisenatide, improves glycemia, but its effects on CV events have not been thoroughly evaluated.METHODS: ELIXA (www.clinicaltrials.gov no. NCT01147250) is a randomized, double-blind, placebo-controlled, parallel-group, multicenter study of lixisenatide in patients with T2DM and a recent ACS event. The primary aim is to evaluate the effects of lixisenatide on CV morbidity and mortality in a population …

Malemedicine.medical_specialtyAcute coronary syndromePopulationLIXisenatide610 Medicine & healthHypoglycemiaPlacebop38 Mitogen-Activated Protein Kinases11171 Cardiocentro Ticino2705 Cardiology and Cardiovascular Medicinelaw.inventionSettore MED/13 - EndocrinologiaAcute Coronary Syndrome; Aged; Cardiovascular Diseases; Double-Blind Method; Female; Glucagon-Like Peptide 1; Humans; Male; Middle Aged; Peptides; Placebos; Protein Kinase Inhibitors; Research Design; p38 Mitogen-Activated Protein Kinases; Cardiology and Cardiovascular MedicinePlacebosLixisenatidechemistry.chemical_compoundRandomized controlled trialDouble-Blind MethodlawGlucagon-Like Peptide 1Internal medicineJournal ArticlemedicineHumansComparative StudyMyocardial infarctionAcute Coronary SyndromeeducationProtein Kinase InhibitorsAgededucation.field_of_studybusiness.industryUnstable anginaResearch Support Non-U.S. Gov'tta3121Middle Agedmedicine.diseaseSurgeryMulticenter StudychemistryCardiovascular DiseasesResearch DesignRandomized Controlled TrialCardiologyFemaleCardiology and Cardiovascular MedicinebusinessPeptides
researchProduct